KEGG   Erysipelothrix rhusiopathiae SY1027: K210_05865Help
Entry
K210_05865        CDS       T02688                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ers  Erysipelothrix rhusiopathiae SY1027
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ers00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    K210_05865
Enzymes [BR:ers01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     K210_05865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1085854..1086756)
Genome map
AA seq 300 aa AA seqDB search
MKVLNFGSMNIDNVYYLDRFVQPGETKDVRKLEVNPGGKGLNQSIAMRRAGIDVCHAGIL
GKGGNVLKEYLDENEVDVHLVKMDDILQGHAIIQVDEIGENCIIVYSGSNGSVDREYIDN
VLTQFDHETMLVLQNEISELEYVVNEAHKRGMTIVLNPSPLTESLKQIDLNKISWLIMNQ
VEAEMMSGCTETEAILDTFKVKYPDLNCVLTLGSKGSVCLYEGSIIEQVAFQTKAVDTTG
AGDTFAGYFVAGMSRNKPIQEVLNDASKAAALCVSRYGAAPSIPYYKDLAQLTSFKGEKR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtccttaattttggttcaatgaatattgacaatgtttactatcttgaccggttt
gtacaacctggagaaaccaaggatgtcagaaaattggaagtaaatcctggtggaaaaggg
ttaaatcagtctattgcaatgaggcgtgcgggcattgatgtctgccatgctggaatttta
ggaaagggagggaatgtacttaaagaatatttagatgagaacgaagttgatgtacatttg
gtcaagatggatgatatcttgcaagggcatgcaatcatacaggttgatgaaattggtgaa
aactgcattatcgtttacagcggttcaaacggaagcgtggatcgtgagtatattgataat
gtcttaactcagtttgatcacgaaaccatgcttgttttacaaaatgaaatcagtgagttg
gagtacgtggtcaatgaagcacacaaacgtggaatgaccattgttcttaatccgtccccc
cttactgaaagtctaaagcaaatagatttaaataagatcagttggttgattatgaaccaa
gttgaggcagaaatgatgagtggttgcacggaaacggaggccattctggatacatttaaa
gtgaagtacccagatttaaattgtgtactaacgcttgggagcaaaggaagcgtgtgtctc
tatgaaggaagcatcatcgagcaggttgcttttcaaaccaaggctgtcgatacaaccgga
gctggggatacgtttgcaggatattttgtagcgggtatgagtcgcaacaaaccaatccaa
gaggtattaaacgatgcatcaaaggccgcagcattgtgtgttagtcgttatggagcggca
ccatcaataccctattataaagatttagctcagttaacatcattcaaaggagaaaaacga
tga

DBGET integrated database retrieval system