KEGG   Erysipelothrix rhusiopathiae SY1027: K210_06580Help
Entry
K210_06580        CDS       T02688                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ers  Erysipelothrix rhusiopathiae SY1027
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ers00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    K210_06580
Enzymes [BR:ers01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     K210_06580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1214945..1215559)
Genome map
AA seq 204 aa AA seqDB search
MMYHQYQEGYIEVITGCMFAGKTEELIRRINVLKFAHKNIIVFKPAVDNRYSDSKVVSHA
GTSVQSVVVDKATDILKYVTKETDVVAIDEVQFFDEEIVKVCDHLALEGKRVMVAGLDMD
FRGEPFGVIPKLMTTAEFVTKLTAVCTECGAPATRTQRLVNGKPASYHDPVVMIGASESY
EARCRHDHIVLDKPQINGNSEGDK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatcatcaatatcaagagggttatatcgaagtcattaccggttgtatgtttgct
gggaagacagaagagttaattcgtcgtattaatgttttaaaatttgcacataaaaacatt
attgtttttaagccagctgtggataatcgctacagtgacagtaaggtcgtttcgcatgcg
ggaactagcgtgcaaagtgttgtagttgataaggcgacagacatcttaaaatacgttact
aaagaaacggatgttgttgcaattgatgaagttcaattctttgatgaagaaattgttaag
gtatgtgaccatcttgccttagaaggcaaacgcgtaatggtagcaggtcttgacatggat
tttcgtggtgaaccttttggcgtaattcctaaattaatgactactgcagagtttgttaca
aaacttacagcggtttgtactgaatgtggcgcacctgcgacacgtacacaacgtttagta
aatggaaaaccggcatcctatcatgatccagttgtcatgattggagcaagtgaatcgtat
gaagcacgatgccgtcatgaccatattgttttggataaacctcaaattaatggaaatagc
gaaggtgataaataa

DBGET integrated database retrieval system