KEGG   Erysipelothrix rhusiopathiae SY1027: K210_06720Help
Entry
K210_06720        CDS       T02688                                 

Definition
(GenBank) acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ers  Erysipelothrix rhusiopathiae SY1027
Pathway
ers00071  Fatty acid degradation
ers00072  Synthesis and degradation of ketone bodies
ers00280  Valine, leucine and isoleucine degradation
ers00310  Lysine degradation
ers00362  Benzoate degradation
ers00380  Tryptophan metabolism
ers00620  Pyruvate metabolism
ers00630  Glyoxylate and dicarboxylate metabolism
ers00640  Propanoate metabolism
ers00650  Butanoate metabolism
ers00900  Terpenoid backbone biosynthesis
ers01100  Metabolic pathways
ers01110  Biosynthesis of secondary metabolites
ers01120  Microbial metabolism in diverse environments
ers01130  Biosynthesis of antibiotics
ers01200  Carbon metabolism
ers01212  Fatty acid metabolism
ers02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ers00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    K210_06720
   00630 Glyoxylate and dicarboxylate metabolism
    K210_06720
   00640 Propanoate metabolism
    K210_06720
   00650 Butanoate metabolism
    K210_06720
  Lipid metabolism
   00071 Fatty acid degradation
    K210_06720
   00072 Synthesis and degradation of ketone bodies
    K210_06720
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    K210_06720
   00310 Lysine degradation
    K210_06720
   00380 Tryptophan metabolism
    K210_06720
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    K210_06720
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    K210_06720
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    K210_06720
Enzymes [BR:ers01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     K210_06720
Exosome [BR:ers04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   K210_06720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: AGN24932
Position
complement(1237085..1238263)
Genome map
AA seq 392 aa AA seqDB search
MRDVVIVSAARTAIGKFGGSFLKTSAVELGTAVIKEAIHRAKISPEDVEYVVMGNVIQTG
LGQNPARQASVFSGIPYSTPAMTINEMCGSGMKSIHLGMQSIMLGEKDVVVVGGFENMSQ
APHIIKNGRFGSKFQNLETEDTIQKDGFVDAFTNELMGVTAEKVAEQFNISREDQDAFAL
ESQMRATRALEAGLFKDEIVPVNNGRDLIDTDEFIRTNSTLEGLQRLKPSFKLDGTVTAG
NASGVNDGAAALVLMSREKAEAMNLDIIATIKGFSEVGVDPEIMGYAPFYAVKSLAEKTN
TDLNTVDRFELNEAFASQSLAVCRDLNLDLNKVNVNGGAISIGHPIGASGARIMVTLIYE
LIHSDTKRGIASLCIGGGMGVAMMIEREEPTK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagacgtagttatagtcagtgctgcgcgcactgcgataggtaaattcgggggaagc
ttcttgaagacttcagctgtagaattaggaactgcagtgattaaagaagcgattcatcgt
gcaaagatttcgccggaagatgttgaatacgtagtaatgggtaatgtcatccaaactgga
ttaggacaaaaccctgcgcgacaagcatcggtgttttctggaattccctattcaacacca
gccatgacaattaatgagatgtgcggttcggggatgaagtcaattcatcttggaatgcaa
tccattatgcttggtgagaaggatgttgtagtagtgggtggttttgaaaatatgtcgcaa
gcacctcatataataaagaatggtcgctttggttcgaaatttcaaaacttggaaacagaa
gatacaattcaaaaagatggttttgttgacgcgtttaccaatgaattgatgggtgttaca
gcggaaaaagtcgctgaacaatttaatatatcccgtgaggatcaagatgcgtttgcttta
gaatcacaaatgcgtgcaacacgtgctcttgaggcaggactttttaaagatgaaattgtt
ccagttaataatggacgtgatcttatcgatacggatgagtttatcagaacaaattctacg
cttgaaggacttcaacgtttaaaaccaagttttaaacttgatggaacggttacagcgggt
aatgcttctggggttaatgatggtgctgctgcacttgtattaatgagtcgtgaaaaggca
gaggcaatgaatttagatattattgctaccattaaaggcttctcggaagtaggcgttgat
cctgaaattatgggttatgcacctttctatgcagttaaatccttagcagagaaaacaaat
acagatttaaatacagttgatcgatttgaattaaacgaagcttttgcttcacaatcgtta
gcggtatgtagagatttaaatttagatttaaataaagtgaatgttaatgggggagcgatc
tcaattgggcatccaattggtgcatcgggcgctcgtattatggttactttaatttatgaa
ttaattcattcagatacaaaacgtggtattgcttcgttatgtattggtggcggcatgggt
gtcgcaatgatgattgaacgagaagaacctacgaagtag

DBGET integrated database retrieval system