KEGG   Erysipelothrix rhusiopathiae SY1027: K210_07345Help
Entry
K210_07345        CDS       T02688                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ers  Erysipelothrix rhusiopathiae SY1027
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ers01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ers00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1363903..1364733
Genome map
AA seq 276 aa AA seqDB search
MNREVLRDKKRIVVKVGSSSLTHKESGDLNFRKLEQLVRVLADLKSQGKEVVLVSSGAQA
VGRKALNLSQIPDKMAKKQALAAIGQAKLMMTYQRLFAEYNQIVAQVLLTKHTMFKEESR
NNAKNTFHELLEMGVIPIVNENDTVATHEIEFGDNDHLSAFVLAMIDADLLIILSDIDGF
YTDDPSQNEDARLIEYVEKIDERHLKMGKETSSSAVGTGGMSAKIDAGRIVTSSGADMVL
ANGKDVNILHQILDGEVVGTYFKANKSESFDLEAYL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaatagagaagttttgagagataaaaaacgtattgttgtgaaagtagggtcatcatcc
cttacgcataaagaatcaggagatttaaattttcgtaaactggagcaactcgtccgcgtt
ttggctgatttaaaaagccaaggtaaagaagttgtgcttgtgtcttctggagcacaagct
gttggtcgaaaggctttaaatctatctcaaatccccgataaaatggctaaaaagcaggca
ttagcggcgattggtcaagccaaattaatgatgacgtaccaacggttatttgcggagtat
aatcaaattgttgcgcaagtattgcttacaaagcatacaatgtttaaagaagaaagtcgt
aataacgcgaagaataccttccatgaactgttagaaatgggtgttattccgattgtgaat
gaaaatgataccgttgcgacgcatgagattgagtttggggataatgaccatctcagtgcg
tttgtacttgcgatgattgatgcggatttactcattattctttcggatattgatggattt
tacacggatgatccatcacaaaatgaagatgcacgacttatcgaatatgtggagaaaatt
gatgagcgtcatctaaagatgggaaaagaaacaagttcgtctgcagttggtacgggtggt
atgagtgccaagattgatgcaggtcgcattgtaaccagttcgggagcagatatggttttg
gcgaacgggaaagacgtgaatattcttcatcaaattcttgatggggaagtagttggaact
tattttaaagcaaataaatcagaatcgtttgatttagaagcttatttatag

DBGET integrated database retrieval system