KEGG   Eubacterium rectale DSM 17629: EUR_01360Help
Entry
EUR_01360         CDS       T02587                                 

Definition
maltooligosyl trehalose synthase (EC:2.4.1.7 5.4.99.15)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ert00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUR_01360
Enzymes [BR:ert01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     EUR_01360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
140570..142045
Genome map
AA seq 491 aa AA seqDB search
MNNKPMLNAYPDSLGGKLSDIAALLKKKEMQDTFSSFYILPSLYHSDLDRGFSVVDYNLN
EELATIEDLSQLKELGIDLKLDFILNHASAQSPQFKDLVEKGDESEYRDFFIDWNKFWEG
HGLMTDEGYIQPDESCLKQMFFRKPGLPILMVEFPDGRRVPYWNTFYQEVHGREYLGQMD
LNIKSEKVWDFYRETLEKIASYGAAIVRLDAFAYAPKAPGKKNFLNDPETWEFLQQIHEL
AAPLGLTLLPEIHAAYEEKIYKTLADKGYATYDFFLPGLIIDAIENRRADYLAKWAREIV
EDKISTVNMLGCHDGIPLLDLKGLLPEDDIRSLIDLIVSRGGMVKNLHGQKNIYYQVNAT
YYSALGESDSKMLLARAIQMFMPGKPQVWYLDLFAGKNDHEAVRRAGESGHKEINRTNLS
ASDIREALKKDVVAKQLELLRMRNTHKAFEKGAVITVAGEGPKLSIRYDNGEAYALLTVD
FEAGAYEIELS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaacctatgcttaatgcatatcctgacagtctgggcggtaagctttccgat
atcgcagcgctgctcaaaaagaaggaaatgcaggacacattttcatcattttatattctg
ccaagcctgtatcattcggatttggaccgcggattttcggtcgtggactacaatctgaat
gaggagcttgcgacaatagaggatttatcgcaattgaaggagctggggattgacttaaag
cttgactttattttaaatcatgcttcggcacagtcaccacagttcaaggatcttgtggaa
aagggcgatgagtcggagtaccgcgactttttcatagactggaacaaattctgggaaggt
catggactcatgacggacgagggctacatacagcctgatgagtcatgcttaaagcagatg
tttttcagaaagccggggcttccgattctcatggttgagtttccggatggacgaagggtg
ccatactggaacacattttaccaggaggtgcatggcagagagtatctgggacagatggat
ttaaatataaagtccgaaaaggtgtgggatttctatcgtgaaacactggaaaaaatagca
tcctacggtgcggctatcgtgagactcgatgcatttgcctatgcgcctaaggcaccggga
aaaaagaatttcctgaatgatcctgagacctgggaatttctacagcagattcacgagctt
gcagcaccgcttggactgactctgctgcctgaaatacacgcggcatatgaggaaaaaata
tacaaaactcttgcagataagggctatgccacatatgatttctttttaccgggactgata
attgatgcgattgagaacaggagagcagattatctggcgaaatgggcgcgtgagattgtg
gaagataaaatctcaacagtcaatatgcttggctgccatgacggcatacctcttctggac
ttaaagggtctgcttccggaggatgatattcgctcgcttatagatttgattgtatctcgt
ggcggcatggtcaaaaatcttcacggacagaagaatatatattatcaggtcaatgccaca
tattacagtgcgcttggtgagtctgacagcaaaatgcttctggcccgtgccattcagatg
tttatgccggggaagccgcaggtatggtatctggatctctttgcaggcaaaaatgaccat
gaggcagtaagacgcgcaggagaatcaggacacaaggaaattaacagaacaaaccttagt
gcctccgatatcagggaggcgctaaaaaaggatgttgttgcaaagcagcttgagctgctt
cgcatgagaaatacacataaggcatttgagaagggggctgtcataacagtagcaggagaa
ggaccaaagctctcaatccgctatgataacggtgaagcgtatgcgcttcttacggtggat
tttgaagccggagcatatgagatagagctgagctga

DBGET integrated database retrieval system