KEGG   Eubacterium rectale DSM 17629: EUR_02280Help
Entry
EUR_02280         CDS       T02587                                 

Definition
Endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ert00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUR_02280
Enzymes [BR:ert01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     EUR_02280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
246972..248144
Genome map
AA seq 390 aa AA seqDB search
MKKYIALVLVAVLVLGIFTGCGNKGNKETESQTDEKATESVNSAENNTEDSTQSSTEIST
ENQNVADTEQLTTENGQESSVLACPSVNGKLHVEGSKLVDQNNNEVQLRGVSTHGLAWYP
QYVTNDCFATLKSFGANVVRLAMYTYESGGYCTDGDRQQLETLVQNGVQYAFNNDMYVII
DWHVLNEGNPNRYSDVAKTFFAKMAQQYASYNNVIYEICNEPCKGATWGDVKFYASEVIP
SIRSYDKDAVILIGTPNWSQDVDEAVKDPVTGYDNIMYTLHFYAATHKEDLQNKLKSAAD
AGLPIFVSEFGICSADGNGQVDIDSANSWISLLDSYGISYVCWNLSNKDEKSALLTPACD
KTSGFTYEDLSDEGKWLYGVLTSHVTPVLN
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatatatagcattggtattggttgcagtgctggtgcttgggatttttacagga
tgtggtaacaagggcaacaaggagacagaatcacagacggatgagaaagccactgagtcg
gtgaattctgcagaaaataatactgaggacagtacgcaaagcagtacagaaatcagtaca
gaaaatcagaatgtggctgacacagagcagctcaccacagaaaacggacaggagagctca
gttcttgcctgtccgtcagtaaacggtaagctgcatgtggagggcagcaagctcgttgat
caaaataacaacgaggtgcagcttcgcggagtcagcacacacggtcttgcgtggtatcca
cagtatgtgaccaatgattgctttgccacgctgaaaagctttggagcaaatgtggtaagg
ctcgccatgtacacttacgaaagcggtggatactgcacggacggtgacaggcagcagctt
gagacacttgtgcaaaacggagtgcagtacgcgttcaacaacgacatgtatgtcatcatc
gactggcatgtgctaaacgagggcaatccaaaccgctacagtgatgtggcaaagacattt
tttgccaaaatggcacagcagtatgcttcatacaacaacgtgatttacgagatttgtaat
gagccgtgcaaaggtgcgacctggggagatgtgaagttttatgccagcgaggtcattccg
tcaatcagaagctacgacaaggatgcagtcatactgataggcacacctaactggagccag
gatgtggatgaggcagtcaaggaccctgtcacaggctatgataatatcatgtatacatta
catttctatgccgcgacccacaaggaggacttgcaaaacaagctaaaatcggcggcagac
gccggactgccgatatttgtatcagagtttggcatctgcagcgccgacggaaacggtcag
gtggacatagattccgcaaacagctggatcagcctgcttgacagctacggtatcagctat
gtgtgctggaatctgtccaataaggacgaaaaatcagcgcttctaacacctgcctgcgat
aagacaagcggctttacctatgaggatctaagcgatgagggcaagtggctgtacggtgtg
ctcacaagtcatgtgacaccggtcttgaattaa

DBGET integrated database retrieval system