KEGG   Eubacterium rectale DSM 17629: EUR_12240Help
Entry
EUR_12240         CDS       T02587                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ert00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EUR_12240
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EUR_12240
Enzymes [BR:ert01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     EUR_12240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1241891..1242805
Genome map
AA seq 304 aa AA seqDB search
MRNVIMYAFRLTIGKMIEMSFLDNYKRVVIKIGSSTLTHAETGSLNFSKMERLVRSICDY
RNSGMDVCLVSSGAIAVGRDVIGIKERPSDISIKQACAAVGQGRLMMTYQKLFSEYNQNS
GQVLMTKNTIVNPVSRRNVMNTFEELFDLNVVPIVNENDTVSTYEMQFGDNDTLSAIVTS
ITKADLLILLSDIDGLYSDDPHDNPDAKLIREVDTLDRRILGMAKSSTGSDVGTGGMATK
LTAAKIATYSGADMIIANGGNMGILYDIMNDRYTGTLFHRAKDAEFVLADYIQREMAPTS
TGGQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatgtaattatgtatgcatttagacttacaataggaaagatgatagaaatgagt
tttttagacaattataaaagagtggtaataaagataggctcatcgacactgacacatgca
gagacgggaagcctcaatttttcaaagatggagcgtctggtgcgctcgatatgtgattac
agaaacagcggaatggatgtgtgcctcgtaagctccggcgctatcgcggttggacgtgat
gtgataggcataaaggagcgtccgagcgacatttcaataaagcaggcatgcgccgcagtg
ggacagggcaggcttatgatgacatatcagaagcttttttccgagtataatcagaattcc
ggacaggtgctcatgacaaagaataccatagtcaatcctgtttccagacgcaatgttatg
aatacatttgaggagctttttgatctgaacgtggtgcctattgtcaatgaaaatgatacg
gtaagcacatacgagatgcagtttggtgacaatgatacgctgtctgctattgttacatca
atcacgaaggctgatctgctcatactgctatctgatatagacggactgtattccgacgat
cctcatgacaatccggatgcaaagcttatcagagaggttgatacgcttgacaggagaata
cttggcatggcaaagtcatcaaccggcagcgatgtcggaaccggcggcatggcgacaaag
cttacggcggcaaagattgccacatattccggtgccgatatgattatcgcaaacggcggc
aatatggggattttatatgacattatgaatgacagatatacaggaacacttttccacagg
gcaaaggatgcagagtttgtgcttgcggattatatacaaagagagatggcacctacatct
acaggcggccagtaa

DBGET integrated database retrieval system