KEGG   Eubacterium rectale DSM 17629: EUR_14230Help
Entry
EUR_14230         CDS       T02587                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ert00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1429921..1431495)
Genome map
AA seq 524 aa AA seqDB search
MRTSGVLMPISSLPSQYGIGTMGKEARRFVDFLEKGGQTYWQILPICPTSYGDSPYQSFS
SFAGNPYFIDLELLCKDKLLTKKECESYKWGKKPQYVDYGIMYVNRYALLRKAYERFSKK
TPADYEAFCSKEAEWLDEYTLFMALKNANGGVAWSEWDDALKFRKPEAMEEAKEKYADDI
AFYKMLQYLFFKQWTALKAYANEKGIRIIGDVPIYVAMDSADVWANPTQFYLDKDLNPIE
VAGCPPDAFSADGQLWGNPLFRWDVMKKDSYSWWTKRISAMAKLYDIVRIDHFRGFDSFY
AIPAKDDTAKNGVWKDGPGMDLFNVLEKKLGKLPIIVEDLGFLTPSVKKLLKDSGFPGMK
VIQFAFDSREDSDYLPHNYPQHCVVYTGTHDNDTVMGWMKTAPKDCVRFAKDYLNLTKEE
GYNWGMMRAAWSSVADMAIVPMQDLLGLDSKARINIPSTTGGNWQWRATPEQIDNKLAKK
LHKCMQMYARLREEPEEASDKSDAKETADASTSKTAGCEKKAAK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagaactagcggtgtattaatgccaatctcatcactgccatcacagtatggtattgga
actatgggaaaggaggcaagacgttttgtcgatttccttgagaagggaggtcagacatac
tggcagattcttccaatctgtcctaccagctatggagattctccataccagtcattttca
agcttcgcaggcaatccttattttatcgatctggagcttttatgcaaggacaagcttctg
acaaagaaggagtgcgagtcatataagtggggcaaaaagccacagtatgtagactatggc
attatgtatgtcaacagatatgctcttttaagaaaggcatatgagcgtttttcaaagaaa
acaccggctgactatgaggcattctgcagtaaagaggcagagtggcttgatgagtacaca
ctctttatggcattaaagaatgccaatggcggagtggcatggagcgagtgggatgatgct
cttaagtttagaaaacctgaggctatggaagaagcaaaggagaagtatgcagatgatatt
gccttctacaagatgctccagtatctcttcttcaagcagtggactgctttaaaggcatat
gctaatgaaaagggcataagaattatcggagatgtacctatttatgttgccatggattca
gcagatgtatgggctaatcctacacagttctatctcgataaagacttaaatccaatcgag
gtggcaggatgtcctcctgatgccttctcagctgacggacagctctggggcaatcctctt
ttcagatgggatgttatgaagaaggacagctacagctggtggacaaagcgtatcagtgct
atggcaaagctatatgatatagtacgaatcgatcatttcagaggttttgattcattctat
gctattcctgcaaaggatgatacagcaaagaacggtgtatggaaagatggacctggcatg
gatttattcaacgtgcttgagaagaagcttggcaagcttcctatcatcgtggaggacctc
ggcttcctcacaccttccgtaaagaagcttttaaaggattcaggcttccctggcatgaag
gttatccagtttgccttcgattcaagagaagatagcgattatctgccacataactatccg
cagcactgtgttgtatacacaggtacccatgacaatgacacagttatgggctggatgaag
acagctccaaaggattgcgtaaggtttgcaaaggattacttaaacctcacaaaggaggag
ggctacaactggggcatgatgcgtgcggcatggtcatcagttgccgatatggctattgtt
cctatgcaggatctgcttggacttgattcaaaggcccgtatcaacattccttcaactacc
ggtggcaactggcagtggagagctactcctgagcagatagacaataagcttgcaaagaag
ctccacaagtgtatgcagatgtatgcacgtctgagagaggagcctgaggaggcttctgac
aaatcagatgctaaagaaacagctgatgcttctacaagcaagacagcaggatgtgagaaa
aaggctgctaagtag

DBGET integrated database retrieval system