KEGG   Eubacterium rectale DSM 17629: EUR_14230Help
Entry
EUR_14230         CDS       T02587                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ert00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EUR_14230
Enzymes [BR:ert01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     EUR_14230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1429921..1431495)
Genome map
AA seq 524 aa AA seqDB search
MRTSGVLMPISSLPSQYGIGTMGKEARRFVDFLEKGGQTYWQILPICPTSYGDSPYQSFS
SFAGNPYFIDLELLCKDKLLTKKECESYKWGKKPQYVDYGIMYVNRYALLRKAYERFSKK
TPADYEAFCSKEAEWLDEYTLFMALKNANGGVAWSEWDDALKFRKPEAMEEAKEKYADDI
AFYKMLQYLFFKQWTALKAYANEKGIRIIGDVPIYVAMDSADVWANPTQFYLDKDLNPIE
VAGCPPDAFSADGQLWGNPLFRWDVMKKDSYSWWTKRISAMAKLYDIVRIDHFRGFDSFY
AIPAKDDTAKNGVWKDGPGMDLFNVLEKKLGKLPIIVEDLGFLTPSVKKLLKDSGFPGMK
VIQFAFDSREDSDYLPHNYPQHCVVYTGTHDNDTVMGWMKTAPKDCVRFAKDYLNLTKEE
GYNWGMMRAAWSSVADMAIVPMQDLLGLDSKARINIPSTTGGNWQWRATPEQIDNKLAKK
LHKCMQMYARLREEPEEASDKSDAKETADASTSKTAGCEKKAAK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagaactagcggtgtattaatgccaatctcatcactgccatcacagtatggtattgga
actatgggaaaggaggcaagacgttttgtcgatttccttgagaagggaggtcagacatac
tggcagattcttccaatctgtcctaccagctatggagattctccataccagtcattttca
agcttcgcaggcaatccttattttatcgatctggagcttttatgcaaggacaagcttctg
acaaagaaggagtgcgagtcatataagtggggcaaaaagccacagtatgtagactatggc
attatgtatgtcaacagatatgctcttttaagaaaggcatatgagcgtttttcaaagaaa
acaccggctgactatgaggcattctgcagtaaagaggcagagtggcttgatgagtacaca
ctctttatggcattaaagaatgccaatggcggagtggcatggagcgagtgggatgatgct
cttaagtttagaaaacctgaggctatggaagaagcaaaggagaagtatgcagatgatatt
gccttctacaagatgctccagtatctcttcttcaagcagtggactgctttaaaggcatat
gctaatgaaaagggcataagaattatcggagatgtacctatttatgttgccatggattca
gcagatgtatgggctaatcctacacagttctatctcgataaagacttaaatccaatcgag
gtggcaggatgtcctcctgatgccttctcagctgacggacagctctggggcaatcctctt
ttcagatgggatgttatgaagaaggacagctacagctggtggacaaagcgtatcagtgct
atggcaaagctatatgatatagtacgaatcgatcatttcagaggttttgattcattctat
gctattcctgcaaaggatgatacagcaaagaacggtgtatggaaagatggacctggcatg
gatttattcaacgtgcttgagaagaagcttggcaagcttcctatcatcgtggaggacctc
ggcttcctcacaccttccgtaaagaagcttttaaaggattcaggcttccctggcatgaag
gttatccagtttgccttcgattcaagagaagatagcgattatctgccacataactatccg
cagcactgtgttgtatacacaggtacccatgacaatgacacagttatgggctggatgaag
acagctccaaaggattgcgtaaggtttgcaaaggattacttaaacctcacaaaggaggag
ggctacaactggggcatgatgcgtgcggcatggtcatcagttgccgatatggctattgtt
cctatgcaggatctgcttggacttgattcaaaggcccgtatcaacattccttcaactacc
ggtggcaactggcagtggagagctactcctgagcagatagacaataagcttgcaaagaag
ctccacaagtgtatgcagatgtatgcacgtctgagagaggagcctgaggaggcttctgac
aaatcagatgctaaagaaacagctgatgcttctacaagcaagacagcaggatgtgagaaa
aaggctgctaagtag

DBGET integrated database retrieval system