KEGG   Eubacterium rectale DSM 17629: EUR_19610Help
Entry
EUR_19610         CDS       T02587                                 

Definition
uroporphyrin-III C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ert00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998564..2000051
Genome map
AA seq 495 aa AA seqDB search
MRENTGKVVLVGAGPGDTGLLTLKGEKYIKQADCLVYDRLSSPEFLSMAKAGCELIYVGK
ENHNHVMKQDAINELLYEKSKYHELVVRLKGGDPYVFGRGGEEALYLVDRNVEVEVVPGV
SSSVAALAAAGIPITHRGIAKGFQVITAHSRKDEEADIDYSLLTDETITCVFLMGLAHVK
SIAAGLMKAGRRADTPTAVISNGTLAAQRKCIGTLADIGEKIEEAKLTSPAIIVVGDVVS
LNDRLDFFEKRPLFGRKITVPYIKTNELIAKLQQLGADVTPVKTGIINPIIIPEFADKVR
SADWIVFTSKNGVRSFFYNLDLAGADIRLIANARFAVVGKATEKELAKHHINADIIPAEQ
TGKGLAGELSSYMGDNDEIKVCIFSAKEASPDLEAGLKEICELEKIDAYVNEQAYESITE
SIGNMVSEAVFTSASNVERFFHMLPENAYVETAYSIGEKTTAALEQHNVREIVQADDSSY
EALVDKISYKDAFKD
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaaacacaggaaaagtagtattagttggagcaggaccgggagatacgggcctg
ctcactttaaaaggagaaaaatatataaaacaggcggattgtctggtgtatgacaggctg
tcatcaccagagtttctttcaatggcaaaggcaggctgtgagcttatttatgtgggcaag
gaaaatcacaaccatgtcatgaagcaggatgccataaacgagcttttgtacgagaaatca
aaatatcatgagcttgtagtccgtttaaagggcggagatccgtatgtatttggaagaggc
ggagaggaagctctctacctggtagatagaaatgtggaggtagaagtggtaccgggtgtc
agttcatcggttgcagcgcttgcggctgcaggaatacctatcacacacagaggcatagca
aaaggctttcaggtcatcactgcgcacagcagaaaggatgaggaggcagatatagactat
tccctccttacagatgagacaatcacctgtgtatttttgatgggacttgcgcatgtaaaa
agcattgcagcagggcttatgaaagcaggacgaagagcggatactccgacagcagtgata
tcgaacggcacacttgctgcgcagcgcaaatgtataggaacgcttgcggatatcggagaa
aagattgaggaagcaaagctgacatcaccggctataatcgttgtgggagatgtggtttca
ctgaatgacaggcttgatttctttgaaaaaagaccgctgtttggaagaaaaatcacagta
ccgtatatcaaaacaaacgaattgatagcaaaattacagcagcttggagcagatgtcaca
ccggttaagacaggcataataaacccgataataattcctgaatttgccgataaggtaaga
tcagctgactggatagtttttacaagcaaaaatggtgtaagatcatttttctataatctg
gatctggcaggggcagacatcaggcttatagcaaatgcaaggtttgcggtggtgggaaaa
gctacagaaaaagagcttgcaaagcatcacataaatgcagatattattccggcagaacag
accggaaaaggacttgcaggagaattgagttcgtatatgggcgataatgatgaaatcaaa
gtctgcattttctcggcaaaggaggcttcacctgaccttgaggcagggcttaaagaaata
tgtgaattagaaaagattgatgcatatgtaaatgagcaggcatatgagagtattactgaa
agcattggaaacatggtaagtgaagctgtttttacaagcgcatcaaatgtggaaagattt
tttcatatgctgccggagaatgcatacgtggaaacagcatactcaataggtgaaaaaaca
acagcagcattagagcagcacaatgtcagagagatagtacaagctgatgatagcagttat
gaagcgctggtagataaaatatcttataaagatgcttttaaagattaa

DBGET integrated database retrieval system