KEGG   Eubacterium rectale DSM 17629: EUR_23200Help
Entry
EUR_23200         CDS       T02587                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
ert00220  Arginine biosynthesis
ert00250  Alanine, aspartate and glutamate metabolism
ert00290  Valine, leucine and isoleucine biosynthesis
ert01100  Metabolic pathways
ert01110  Biosynthesis of secondary metabolites
ert01130  Biosynthesis of antibiotics
ert01210  2-Oxocarboxylic acid metabolism
ert01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ert00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EUR_23200
   00290 Valine, leucine and isoleucine biosynthesis
    EUR_23200
   00220 Arginine biosynthesis
    EUR_23200
Enzymes [BR:ert01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     EUR_23200
    2.6.1.66  valine---pyruvate transaminase
     EUR_23200
Amino acid related enzymes [BR:ert01007]
 Aminotransferase (transaminase)
  Class I
   EUR_23200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Arc
Motif
Other DBs
NCBI-ProteinID: CBK91312
UniProt: D6E0E1
Position
2384005..2385222
Genome map
AA seq 405 aa AA seqDB search
MREFGKSRKLDNVLYDVRGPVVDEAARMEENGTNVLKLNIGNPAPFGFRTPDEVIYDMSR
QLTDCEGYSNSKGLFSARKAIMQYAQLKKLPNVTVEDIYTGNGVSELINLSMSALLDNGD
EVLVPAPDYPLWTACVTLAGGTAVHYICDEQSEWYPDIEDIKKKITDKTKAIVIINPNNP
TGALYPREVLQQIVDVAREHELMIFSDEIYDRLVMDDYEHVSIASLAPDLFCVTFSGLSK
SHMIAGYRIGWMVLSGNKALGKDYIEGLNMLSNMRLCSNVPAQSIVQTALGGYQSVGEYI
VPGGRIYEQREYVYKALNDIPGISAVKPKAAFYIFPKIDTARFNITNDEQFALDLLREKK
ILIIHGGGFNWDKPDHFRVVYLPRTEILKDATGKLADFLSSYKQK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatttggaaaatccagaaaattagataatgtgctttatgatgtaagaggaccg
gtggtggatgaggcggcccgcatggaggaaaacggcacaaatgtgttgaagctcaatata
ggaaatcctgcgccgtttggcttcaggacacctgatgaggtgatatatgatatgtctcgc
cagctcacggactgtgaggggtattccaactccaagggacttttttctgcaagaaaagca
atcatgcaatatgcacagctcaaaaagcttcctaatgtgacggttgaggatatctacacc
ggaaacggagtcagcgagcttataaacttaagcatgtcagcgcttcttgacaatggtgat
gaggtgctggtgccggcaccggactatccgctttggacagcctgcgttacacttgcggga
ggcacggcagtgcactatatctgtgatgagcagtcagagtggtatccggacatagaggat
atcaaaaagaagattacagacaagacaaaggcaatcgtaataataaaccctaataatcct
acgggagcactctatccaagggaggtgctgcagcagatagttgatgtggcaagagagcac
gagcttatgattttttcggatgagatatatgacaggcttgtaatggatgactatgagcat
gtgtctattgcgtcgcttgcaccggacctcttctgtgtgaccttcagcggtctttccaag
tcacatatgatagcaggctatcgtatcggatggatggttttaagcggcaacaaggcgctc
ggaaaggactatatcgagggtctcaacatgctctcaaacatgcgtctttgctcgaatgtt
ccggcgcagtcgatagtgcagacggcattaggcggatatcagagtgtaggcgagtatatt
gtgccgggcggacgaatctatgagcagagagagtacgtctacaaggcattaaacgatata
ccgggaatttcggcagtaaagccaaaggcggcattttacatattcccaaagattgatact
gcaaggttcaacatcacaaacgatgaacagtttgcactggatctgcttcgtgagaagaag
atactcatcatccacggcggcggcttcaactgggataagccggatcacttcagagtggta
tatctgcctcggacagagatattaaaggatgccacaggcaagcttgcagactttttgtct
tcatataagcagaaataa

DBGET integrated database retrieval system