KEGG   Eubacterium rectale DSM 17629: EUR_25150Help
Entry
EUR_25150         CDS       T02587                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ert  Eubacterium rectale DSM 17629
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:ert00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ert00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2586559..2587167
Genome map
AA seq 202 aa AA seqDB search
MGQIKVQKNVGGIEGLCIIEPTVHGDNRGYFMETYNSNDMQEAGIDRVFVQDNQSCSTKG
VLRGLHFQKEYPQAKLVRAVKGSVFDVAVDLRSDSKTYGKWFGVELTEENKKQFLIPEGF
AHGFLVLSDVAEFCYKVTDFWHLGDESGLAWNDPAIGIEWPQLVGEYPGSADGSGYTLED
GTPINLSDKDQKWETLENTFKF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggacagattaaagtacagaaaaacgtaggtggaatcgaaggactttgcatcatcgag
cctacagtacacggagacaaccgtggatactttatggagacatacaattcaaatgacatg
caggaggcaggcattgacagggtattcgtacaggataatcagtcttgttcaacaaaggga
gtgctccgcggactccatttccagaaggaatacccacaggcaaagcttgtgcgtgcagta
aaaggctcagtatttgatgtggctgtagacttaagaagcgattcaaagacatatggcaag
tggtttggagtagagcttacagaagagaacaagaagcagttccttatcccagagggtttt
gcacacggatttttagtactctcagatgtagcagagttctgctacaaggtaacagatttc
tggcaccttggagacgagagcggacttgcatggaatgatccggcaatcggcatcgagtgg
ccacagcttgtcggagagtatccgggaagcgccgacggaagcggatacacacttgaggat
ggcacaccaatcaatttaagtgataaggatcagaagtgggagacactggagaatacattt
aagttctag

DBGET integrated database retrieval system