KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum1891Help
Entry
Erum1891          CDS       T00224                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Erum1891 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Erum1891 (sdhD)
   00650 Butanoate metabolism
    Erum1891 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Erum1891 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
329014..329364
Genome map
AA seq 116 aa AA seqDB search
MGSSVYHWLSQRLTAFIMLPFSVWFFYKFLRFLSIVCKSVSELDLSFVELNTIDVIASVC
FFIIAFYHAILGLQVILEDYVQSSVLRVSILLLIKGIVTVTLLFLIFAIFNISLNF
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtgggtagctcagtttatcattggttatctcaaagacttacagcatttattatgttacct
ttttctgtatggtttttttataagtttttacgttttctttctatagtgtgtaaatctgtt
tcagaacttgatttaagttttgtggaactaaatactattgatgtaattgcgtcagtatgt
ttttttattattgctttttatcatgcaattttagggttacaagttatattagaagattat
gtccaatcttctgtattaagagtatctattcttttattaataaaagggattgtaactgta
actttgttatttttaatttttgctatatttaatatctcgttaaatttctag

DBGET integrated database retrieval system