KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum1891Help
Entry
Erum1891          CDS       T00224                                 

Gene name
probable_sdhD
Definition
(GenBank) putative succinate dehydrogenase cytochrome b small subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru00020  Citrate cycle (TCA cycle)
eru00190  Oxidative phosphorylation
eru00650  Butanoate metabolism
eru01100  Metabolic pathways
eru01110  Biosynthesis of secondary metabolites
eru01120  Microbial metabolism in diverse environments
eru01130  Biosynthesis of antibiotics
eru01200  Carbon metabolism
Module
eru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eru_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Erum1891 (probable_sdhD)
   00650 Butanoate metabolism
    Erum1891 (probable_sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Erum1891 (probable_sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAH57907
Position
329014..329364
Genome map
AA seq 116 aa AA seqDB search
MGSSVYHWLSQRLTAFIMLPFSVWFFYKFLRFLSIVCKSVSELDLSFVELNTIDVIASVC
FFIIAFYHAILGLQVILEDYVQSSVLRVSILLLIKGIVTVTLLFLIFAIFNISLNF
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtgggtagctcagtttatcattggttatctcaaagacttacagcatttattatgttacct
ttttctgtatggtttttttataagtttttacgttttctttctatagtgtgtaaatctgtt
tcagaacttgatttaagttttgtggaactaaatactattgatgtaattgcgtcagtatgt
ttttttattattgctttttatcatgcaattttagggttacaagttatattagaagattat
gtccaatcttctgtattaagagtatctattcttttattaataaaagggattgtaactgta
actttgttatttttaatttttgctatatttaatatctcgttaaatttctag

DBGET integrated database retrieval system