KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum2570Help
Entry
Erum2570          CDS       T00224                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eru00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Erum2570 (recR)
DNA repair and recombination proteins [BR:eru03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Erum2570 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
442689..443276
Genome map
AA seq 195 aa AA seqDB search
MDINKLINMFAKLPNLGSSSSRRIVLYLLRNREEIMLPLASSIQELALKTKECSICFNID
VKSPCSICSDVKRDQKLLCIVEELGDLWAFEKGKIYQGVYHVLGGTLSAIYGIGPDQLNF
NNIIARIQNSGVQEVIIGISNTMDGQVTTHYITQMIKKLGVKVTRLACGIPMGGEIDYLD
EGTLSAALSSRYVIS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggatattaataaattaattaatatgtttgcaaaattaccaaatttagggtcatcttct
tctaggaggatagtactttatttacttcgtaatagagaagaaataatgttacctttagca
tcaagtattcaagagttggcgcttaaaaccaaggagtgttctatatgttttaatatagat
gtaaagtctccatgtagtatttgttctgatgttaagcgtgatcagaaattattatgtata
gttgaagaattaggagatttatgggcatttgaaaagggtaaaatatatcaaggggtatat
catgttctaggaggtactttatctgctatttatggaataggtccagatcaattgaacttt
aataatattattgcaaggatacaaaactctggggttcaggaagtgataataggtattagt
aatactatggatgggcaagttactacacattatataacacaaatgataaaaaaattagga
gttaaagttactaggttagcatgtggtattcctatgggtggagaaatagattatttagat
gaaggtacattaagtgctgcattatcttctaggtatgttatttcttag

DBGET integrated database retrieval system