KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum2570Help
Entry
Erum2570          CDS       T00224                                 

Gene name
probable_recR
Definition
(GenBank) putative recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eru00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Erum2570 (probable_recR)
DNA repair and recombination proteins [BR:eru03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Erum2570 (probable_recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Erum2570 (probable_recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
442689..443276
Genome map
AA seq 195 aa AA seqDB search
MDINKLINMFAKLPNLGSSSSRRIVLYLLRNREEIMLPLASSIQELALKTKECSICFNID
VKSPCSICSDVKRDQKLLCIVEELGDLWAFEKGKIYQGVYHVLGGTLSAIYGIGPDQLNF
NNIIARIQNSGVQEVIIGISNTMDGQVTTHYITQMIKKLGVKVTRLACGIPMGGEIDYLD
EGTLSAALSSRYVIS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggatattaataaattaattaatatgtttgcaaaattaccaaatttagggtcatcttct
tctaggaggatagtactttatttacttcgtaatagagaagaaataatgttacctttagca
tcaagtattcaagagttggcgcttaaaaccaaggagtgttctatatgttttaatatagat
gtaaagtctccatgtagtatttgttctgatgttaagcgtgatcagaaattattatgtata
gttgaagaattaggagatttatgggcatttgaaaagggtaaaatatatcaaggggtatat
catgttctaggaggtactttatctgctatttatggaataggtccagatcaattgaacttt
aataatattattgcaaggatacaaaactctggggttcaggaagtgataataggtattagt
aatactatggatgggcaagttactacacattatataacacaaatgataaaaaaattagga
gttaaagttactaggttagcatgtggtattcctatgggtggagaaatagattatttagat
gaaggtacattaagtgctgcattatcttctaggtatgttatttcttag

DBGET integrated database retrieval system