KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum2720Help
Entry
Erum2720          CDS       T00224                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru00860  Porphyrin and chlorophyll metabolism
eru01100  Metabolic pathways
eru01110  Biosynthesis of secondary metabolites
eru01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Erum2720 (hemB)
Enzymes [BR:eru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Erum2720 (hemB)
Exosome [BR:eru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Erum2720 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: CAH57989
Position
complement(474068..475057)
Genome map
AA seq 329 aa AA seqDB search
MQFPTTRLRRKRSHQWLRNLVRENNLSVNDLILPLFVHDDEGVSEPIKQLPDIKRYSIPE
LLNVVAQAADLGINAIALFPVVKNNLKSEKAEEAFNPNNLICRAIKTLKDNIPKIGIIAD
VALDPYTISGHDGIIIDQKIDNDATVATLCKQALVLAAAGCDIIAPSDMMDGRIKEIRNS
LDNCNFQDICILSYAVKYCSSFYKPFREAVGSCKTSKTIDKSTYQVDAGNINEALIEVQM
DINEGADIVMIKPGMPYLDVIKSVSQKYEIPIFAYQVSGEYAMIKVASQNHLLDYDQAIY
ESLLSFKRAGAKSILTYAAMDVALMILNN
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttcctaccacaagactaagacgtaaacgctcacatcaatggttacgcaatcta
gtaagagaaaataatctatctgtaaatgatctaattcttcccttattcgttcatgatgat
gaaggagtatcagaacccataaaacaattaccagatattaaaagatattctatccctgaa
ttgttaaatgtagtagcacaagctgcagatttaggaataaatgcaatagcactatttcca
gtagtaaaaaacaatttaaaatctgaaaaggcagaggaagcattcaaccctaacaacctc
atatgtagagcaataaaaacattgaaagacaacattccaaaaataggcataattgccgat
gtagcactagatccttacacaatttcaggtcatgatggaattatcatagatcaaaaaatt
gataatgatgcaactgtagcaactttatgtaagcaagctttagtattagcagcagcagga
tgtgatattatagcaccttcagacatgatggatggtagaattaaagaaattagaaactca
ctagataactgtaattttcaagacatctgcatcttatcttacgcagtaaaatattgctca
agtttttacaaaccatttcgtgaagctgttggatcatgcaaaacatctaaaactatagac
aaaagtacttatcaagtagatgctggaaatatcaacgaagcacttattgaagtacaaatg
gacattaatgaaggagcagatattgttatgataaaaccagggatgccatatcttgatgtg
atcaaatctgttagtcaaaaatatgaaatccccatatttgcataccaagtaagtggtgaa
tacgcaatgattaaagttgcttcacaaaaccatttattagattacgatcaagctatatat
gaatctttattaagctttaaacgtgcaggagcaaaaagtatacttacatatgcagctatg
gatgtagctcttatgattttaaataattaa

DBGET integrated database retrieval system