KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum2840Help
Entry
Erum2840          CDS       T00224                                 

Gene name
matA
Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Erum2840 (matA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Erum2840 (matA)
Enzymes [BR:eru01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Erum2840 (matA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
502112..503494
Genome map
AA seq 460 aa AA seqDB search
MDSSLPTIRKNKTLDSVFRVMGGMAEAIFSWVGSINKDLTRDQDIKNLYEKMKECLNPKG
GEIKARYNTISLGNLYLNLSDIGKTTFFRLLEEQFSADRNEIDEKIRDYIREIDEYEKRK
LEFELMGVLESPRFCILKQFISLPDGLKFLVDMRADVMQLRDKNQQFFSLEKDLINILSY
WFDIGLLDLHQITWDSPASLLEKLILYEAVHAISSWDDLRDRLDSDRRCFSFFHYKMLNE
PLIFVEVALVDEMASSIQTLLDSHVPPKDPKDAKVAIFYSISNTQRGLSGISLGNFLIKR
VVGKLSEEFQNIKTYATLSPIPGFVKWLTKSLSLDDIEFLNELKITMSVDEIIFHLNEKK
YSSFSQDLKGLFLKLCAYYLVESKNNDKALDPVAHFHLSNGAIIKKLNWMADTSEKGLNC
SMGIMVNYHYELSKIDDNYEDYLVNRKINCSKEVLSLLKR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggatagttcattaccgacaataagaaaaaataagacactagatagtgtattcagagtt
atgggtggaatggctgaagctatattttcttgggttgggagtatcaataaagatttaaca
agggatcaggatatcaaaaacctttatgaaaaaatgaaggaatgtcttaatccgaaaggt
ggggaaattaaggcaagatataatactatatctctcggtaatttgtaccttaatttatct
gatataggtaaaacaacgtttttcaggttattagaggagcagtttagtgctgatagaaat
gagatagatgagaaaataagggattatatacgtgaaatagatgaatacgaaaagagaaaa
cttgaatttgaattgatgggggtacttgaatctcctagattttgtatactaaagcagttt
atttcattaccagatggtttaaagtttcttgttgacatgagggctgatgtcatgcaatta
cgagataaaaatcagcaatttttctctttagaaaaggatttaataaatattctttcttat
tggtttgatattgggcttttggatttgcaccaaattacatgggattctcctgcttctttg
ttagaaaagcttattttatatgaggcagtacatgcaatttcttcatgggatgatttacgt
gatagattggattcagatcgtagatgtttttccttttttcactataaaatgttaaatgaa
ccattgatttttgtagaagtagcacttgttgatgaaatggctagtagcatacaaacatta
ttggattctcatgttcctccgaaagatcctaaggatgccaaagtagcgattttttattca
atatcaaatactcaacgggggctttctgggattagtttaggtaattttctaataaagcgt
gttgtaggtaagttatcggaagagtttcaaaatataaaaacttatgcaacattgtcacca
atacctggttttgtaaaatggcttacaaaatcgttaagtttggatgatattgaattttta
aatgaacttaaaattactatgtctgtagatgaaataatatttcatcttaatgagaagaag
tattctagtttttctcaagatctaaagggattatttctaaagttatgtgcttattactta
gtagaatctaagaataatgataaagcattagatccagtagcacattttcatttaagtaat
ggagcgattataaagaaattaaactggatggctgatacttcagagaaaggattaaactgt
tctatgggtattatggtaaattatcattatgagttatcaaaaatagatgataactatgaa
gattatctagtaaatagaaaaattaattgttcaaaagaagtgttgtcactattgaagcgt
tga

DBGET integrated database retrieval system