KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum3340Help
Entry
Erum3340          CDS       T00224                                 

Gene name
probable_ispE
Definition
(GenBank) putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru00900  Terpenoid backbone biosynthesis
eru01100  Metabolic pathways
eru01110  Biosynthesis of secondary metabolites
eru01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Erum3340 (probable_ispE)
Enzymes [BR:eru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Erum3340 (probable_ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N YrvL
Motif
Other DBs
NCBI-ProteinID: CAH58054
UniProt: Q5HBJ6
Position
582906..583751
Genome map
AA seq 281 aa AA seqDB search
MSKFLVKAPAKINLFLHILGKNSNYHSLESLLVFVNIYDILEVTIDAPRSGVYFTNLKIN
RYNNTITKVIYLLSQHSTSSVNVFVSVIKNILVSAGLAGGSADAAAVMRLLGNVWDIQPQ
VLEELALEIGSDVPACLHSKTLFARGRGEDILLLPDLCLPKYIVIVAPKGKPLSTVKVFN
NYEPSAFSSPICDNLPVRQDDWLELIYNARNDLLDTALKFVPEIEEILFVLRKFRNCLIA
RMTGSGATCFALFNELSDAEVVVRELQMTRPDWIVFNAKIL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaatttttagttaaagcgccagcaaaaattaatttatttttgcacattcttggt
aagaatagtaattatcattctttagagtctttgcttgtttttgttaatatttatgatatt
ttggaggtaactatagatgcaccaagaagtggtgtatattttactaatttaaagattaat
aggtataacaatactataactaaggtgatttacctgttgtcacaacatagtacttcttct
gttaatgtttttgttagtgttatcaaaaatattttagtttctgcaggtttagcaggtggt
tcagctgatgctgctgctgttatgcgtttattagggaatgtatgggatattcaacctcaa
gttttggaggaattagctttagagattggtagtgatgttcctgcatgtttacactcgaaa
actcttttcgctagagggagaggagaagatatattgttacttcctgatttgtgtttacct
aaatatattgttattgttgctccaaaaggtaaaccattaagtactgtaaaagtttttaat
aattatgaaccatctgctttttcttctccgatatgcgataatttaccagtaagacaagat
gattggttagagttaatttataatgcaagaaatgatttattagatactgcattaaagttt
gtacctgaaatagaagaaatactttttgtattgagaaaattcagaaattgcttaatagca
cgtatgactggtagtggggcaacttgttttgctttatttaatgagttaagtgatgctgaa
gttgtagttagagaattacaaatgactcgtcctgattggatagtatttaatgcaaaaata
ctttaa

DBGET integrated database retrieval system