KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum4040Help
Entry
Erum4040          CDS       T00224                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Erum4040 (tpiA)
   01230 Biosynthesis of amino acids
    Erum4040 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Erum4040 (tpiA)
   00051 Fructose and mannose metabolism
    Erum4040 (tpiA)
   00562 Inositol phosphate metabolism
    Erum4040 (tpiA)
Enzymes [BR:eru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Erum4040 (tpiA)
Exosome [BR:eru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Erum4040 (tpiA)
  Exosomal proteins of bladder cancer cells
   Erum4040 (tpiA)
  Exosomal proteins of melanoma cells
   Erum4040 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
707266..707988
Genome map
AA seq 240 aa AA seqDB search
MSLLIVANWKMHGDFFTFSSFTKELSNRLINIEDKVKVVLCPPFIALSTYVNCPHNIKFG
GQNCCYVSSGKYTGEISASMLYNSGCSYVIVGHSERRSTFHETDHDVRLKAECAIESGLI
PIICVGETLLDRENGMLKDTLLSQCSKSFPKNGKFIIAYEPVWAIGNNKIPSTDVIIEAL
EIIRSYDYVSDIIYGGAVNHTNVGDIVSINQLSGVLVGSASLDMESFFNIICSAINVGQS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcattactcatcgttgctaactggaagatgcatggtgatttttttactttttcttcg
tttacaaaggagcttagtaaccgtttaattaatatagaagataaagtaaaggtagtatta
tgcccaccatttattgcgttatctacttatgttaattgtccacataatattaagtttggt
ggacagaactgttgttatgtatctagtgggaagtacactggagaaattagtgctagtatg
ttatataactctggatgtagttatgtaatagtgggtcactctgaaaggaggagtacgttt
catgaaactgatcatgatgttaggttaaaagctgaatgtgcgatcgaatcaggattaata
ccaattatttgtgttggagaaactttactagatagggaaaatggtatgctaaaagatact
ttattaagtcaatgtagtaaatcttttcctaaaaatggtaagtttatcatagcatatgag
ccagtatgggcaatagggaacaataaaataccttctactgatgtaataatagaagcttta
gagattattaggtcatatgattatgtatctgatatcatatatggtggagcagtaaatcat
actaatgtaggtgatattgtcagtataaatcaattatctggtgttttagttggtagtgct
agtttagatatggagagtttttttaatataatatgtagtgctataaatgtggggcaaagt
taa

DBGET integrated database retrieval system