KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum5170Help
Entry
Erum5170          CDS       T00224                                 

Gene name
carA
Definition
carbamoyl phosphate synthase small subunit (EC:6.3.5.5)
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eru00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:eru00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
873909..875033
Genome map
AA seq 374 aa AA seqDB search
MSQIKNYLNAILMLSDGKYFLGKSIGNKSNAVGEVCFTTSMTGYQHTITDPSFAGQIITF
TFPHIGNIGINKEDFENTQVLAHGIVVKTISEDSHSSSYSNLENWMIENKITGISEIDTR
ALTRHLRNYGSQNGIIHHFHDMNSLNLKELQNTASQYNYVNHCQSISQAFISDYNQEPKY
KTLYNIVVINFGVKSSILNALSNIGCKVHIVPGHEFNLIDKILSFNPDGIVLSNGPGDPS
AISEHTIQQIRSIIELKVPTLGICLGHQLIALALGAQVKKMLFGHRGSNHPVYNKMLNNI
EITSQNHGFTIDENSLSSNIQITHTSLFDNTIEGIKVENYPIISVQYHPEGSPGPNDTKY
ILEDFVNLIQEKTV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaataaaaaactatttaaacgctatcctaatgctatctgatggaaaatatttc
cttggaaaatctataggaaacaaatctaatgctgtaggggaagtatgttttactacttca
atgacaggatatcaacatactataacagatccatcatttgcaggccaaataatcacattt
acttttcctcacattggcaacattggaataaataaagaagactttgaaaacactcaagta
ctagcacatggaattgttgtgaaaacaatatcagaagattcccattcaagttcttactca
aacttagaaaattggatgatagaaaataaaataactggaatatctgaaatcgatactaga
gcattaacacgtcacttaagaaactatggatcacaaaatggaattatacatcatttccat
gacatgaattcattaaatctaaaagagttacaaaatacagcatctcaatacaattatgta
aatcattgtcaatcaatttcacaagcttttataagtgattacaatcaagaaccaaagtac
aagaccttatacaacatagtagttattaattttggagtaaagtccagtatattaaatgct
ttatctaatataggatgcaaagtacatatagtaccaggtcatgaatttaatttaatagat
aaaatattatcattcaatccagatggcatagtattatcaaatggtccaggagatccatct
gcaatttctgaacatactatacaacaaattagaagtataatagaattaaaggtaccaaca
ttaggaatctgtctagggcaccaactaattgcactagcattaggtgcacaagttaaaaaa
atgttatttggacatagaggaagtaaccatccagtatataataaaatgctcaataacata
gaaattactagtcagaaccacggatttaccatagatgaaaactcattatcttcaaacata
caaataactcacacatctctgtttgataacacaattgaaggtattaaagtagaaaattat
cccattatttcagtacagtatcatcctgaaggcagtccaggacctaatgatacaaagtac
atattagaagattttgttaatttaatacaggaaaaaactgtataa

DBGET integrated database retrieval system