KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum5380Help
Entry
Erum5380          CDS       T00224                                 

Gene name
hemD
Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Erum5380 (hemD)
Enzymes [BR:eru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Erum5380 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928519..929247
Genome map
AA seq 242 aa AA seqDB search
MKSLLVTRPQEDSIIIKETLTNLGFNIYIEPMFSIKYLPVKLNLEYFDLIISTSKHSIIA
LSKISKNRTQPIITVGDNTKQVAEKLGFSSVTSLNGNIHDIISYIHNNSHLKFLYIRGQE
ITYDLKEIFSNNTIKFYEIILYSTIDKQSLSNHCYNLLFHNRISGILFYSSRTATIFMDL
IKKHNIGHKTSSITVYAMSQKIAETVNNISWKSIKTSDKPTNKSLISLISSDMKIIKEST
LD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctttattagttacacgacctcaggaagactctataataataaaagaaacctta
acaaacttaggctttaatatttacatagagcctatgttctcaataaaatatttacctgta
aaacttaatttagaatatttcgatttaattatatctacaagcaagcacagtattattgca
ttatctaaaattagtaaaaatcgcactcaacccataatcaccgtaggcgataacacaaag
caagttgcagaaaaattaggcttttcatcagtcacatcacttaacggtaatattcatgac
attatatcatacatacacaataattctcatctaaaatttttatatatcagaggacaagaa
ataacatatgacctaaaagagatttttagtaataatactattaaattttatgaaattata
ctatattcgacaatagataaacagtctttaagtaatcattgctataacttactctttcat
aatagaatttctgggatattattctactcttcaagaactgccaccatatttatggattta
ataaaaaagcacaatataggtcataaaacaagcagcataactgtatatgctatgagtcaa
aaaatcgcagaaactgtaaataatatatcctggaaaagtataaaaacttctgataaaccg
actaataaatcactaatttcattaatatcttctgatatgaaaattatcaaagaatccaca
ttagactaa

DBGET integrated database retrieval system