KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum5380Help
Entry
Erum5380          CDS       T00224                                 

Gene name
probable_hemD
Definition
(GenBank) putative uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru00860  Porphyrin and chlorophyll metabolism
eru01100  Metabolic pathways
eru01110  Biosynthesis of secondary metabolites
eru01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Erum5380 (probable_hemD)
Enzymes [BR:eru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Erum5380 (probable_hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: CAH58267
Position
928519..929247
Genome map
AA seq 242 aa AA seqDB search
MKSLLVTRPQEDSIIIKETLTNLGFNIYIEPMFSIKYLPVKLNLEYFDLIISTSKHSIIA
LSKISKNRTQPIITVGDNTKQVAEKLGFSSVTSLNGNIHDIISYIHNNSHLKFLYIRGQE
ITYDLKEIFSNNTIKFYEIILYSTIDKQSLSNHCYNLLFHNRISGILFYSSRTATIFMDL
IKKHNIGHKTSSITVYAMSQKIAETVNNISWKSIKTSDKPTNKSLISLISSDMKIIKEST
LD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctttattagttacacgacctcaggaagactctataataataaaagaaacctta
acaaacttaggctttaatatttacatagagcctatgttctcaataaaatatttacctgta
aaacttaatttagaatatttcgatttaattatatctacaagcaagcacagtattattgca
ttatctaaaattagtaaaaatcgcactcaacccataatcaccgtaggcgataacacaaag
caagttgcagaaaaattaggcttttcatcagtcacatcacttaacggtaatattcatgac
attatatcatacatacacaataattctcatctaaaatttttatatatcagaggacaagaa
ataacatatgacctaaaagagatttttagtaataatactattaaattttatgaaattata
ctatattcgacaatagataaacagtctttaagtaatcattgctataacttactctttcat
aatagaatttctgggatattattctactcttcaagaactgccaccatatttatggattta
ataaaaaagcacaatataggtcataaaacaagcagcataactgtatatgctatgagtcaa
aaaatcgcagaaactgtaaataatatatcctggaaaagtataaaaacttctgataaaccg
actaataaatcactaatttcattaatatcttctgatatgaaaattatcaaagaatccaca
ttagactaa

DBGET integrated database retrieval system