KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum6290Help
Entry
Erum6290          CDS       T00224                                 

Gene name
folP2
Definition
dihydropteroate synthase 2 (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Erum6290 (folP2)
Enzymes [BR:eru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Erum6290 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051496..1052347
Genome map
AA seq 283 aa AA seqDB search
MKFKTQILGCFNFTPDSFSDGGQFFTVEKAIKQTEHLINSGADIIDVGAESGKPRYIYQG
DETLITQEEEWNRLKTILPQIVELAHSRNVKVSLDTRNAKTAEKGLALNVDFINDATGIS
DSNMIPVLLNSSAKIIISHNLGVPLIMGQFIPKGVNPITEIKQWLKDKTTMLINAGINRD
RIIVDPGIGCGKNATQSLYIMKNIDKLKELKYPICLGHSRKSCLMQFDPEDKIRDNPTVI
ASSALFYKNIDFFRVHNAEIHSKAFKVIKTMFQITLKDVYDSL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaacacaaatactaggttgttttaactttacccctgattcattttcagat
ggaggacagttttttactgtagaaaaagcaatcaaacaaacagaacatttaatcaatagt
ggagcagatattatagatgttggagcagaatcaggaaaaccaagatatatatatcaagga
gatgaaactctaattacacaagaagaagaatggaatagactaaaaacaatattaccacaa
attgtagaacttgctcacagccgcaatgttaaagttagtctagatactagaaatgcaaaa
actgcagaaaaaggattggctttaaatgtagacttcattaatgatgctactggaatatca
gatagtaatatgataccagtattattaaatagttctgcaaaaattataatctcacataac
ctaggcgtaccgttaataatgggtcaatttataccaaaaggtgttaacccaataactgaa
attaagcaatggcttaaagataaaactacaatgctgatcaatgcaggaataaatagagat
agaattatcgttgacccaggtataggatgtgggaaaaatgcaacacaatcattatatata
atgaaaaatatagataaattaaaggaactaaagtatccaatatgtcttggccattctcgt
aaatcttgtcttatgcaatttgatccagaagataaaatacgtgataaccctacagtaata
gcatcatctgctttgttttataaaaatatagacttttttagagtacacaatgctgaaata
catagtaaagcatttaaagttataaaaactatgtttcaaattaccttaaaagatgtatat
gattctttataa

DBGET integrated database retrieval system