KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum6520Help
Entry
Erum6520          CDS       T00224                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Erum6520 (folK)
Enzymes [BR:eru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Erum6520 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101277..1101801
Genome map
AA seq 174 aa AA seqDB search
MDYSPDYDIVVLALGSNCGSMLLNIKSAINMLPLYNKTYSYIYKSMALLPENASSDWDTP
FLNMVVSGYTNLSPNLMLERVKYIEKKIGRFNNEYWSPRCIDIDIILWGDKVLDSQTLSI
PHKHMQDRDFVLVPLSDIHARFPHPVSKLSIEEIVLNLREINLIKQSYTITRYL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggattactcacctgactatgatatagtagtactagcattaggtagtaattgtggcagt
atgttattgaatattaaatctgctataaatatgttacctttatataacaaaacatattct
tatatctataaaagcatggcactattaccagaaaatgctagtagtgattgggatactcct
tttctgaatatggtagtatcaggttatacaaatctttcaccaaatcttatgttagaaaga
gttaaatacattgaaaaaaaaataggcaggtttaataatgaatactggtcacctagatgt
atagatattgacattatcttatggggagataaagtcttagattcacaaactttatctatt
cctcataagcatatgcaagatagagattttgtacttgtaccactctctgatattcacgca
agatttcctcacccagtatcaaagctatcaattgaagaaatagttctcaatctacgtgag
atcaatttaataaagcagtcatatactataactcgatatttatag

DBGET integrated database retrieval system