KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum6640Help
Entry
Erum6640          CDS       T00224                                 

Gene name
gshB
Definition
glutathione synthetase (EC:6.3.2.3)
Orthology
K01920  
glutathione synthase [EC:6.3.2.3]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Glutathione metabolism
Metabolic pathways
Module
Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Erum6640 (gshB)
Enzymes [BR:eru01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     Erum6640 (gshB)
Exosome [BR:eru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Erum6640 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1119909..1120847)
Genome map
AA seq 312 aa AA seqDB search
MALVVAFQMDRDVVVGKDVSVKFIQEAQIRGHTVFFFTPDKLAIKNNIPVASACLVTVEQ
EKLKFENVQELFLEDMDIIFIRQNPPFDMRYITSTYILEKLTKPLVINDPKFLRDYPEKL
LPLLFDDFIPDTLITEDYSMLQNFYYEHKDIILKPLYSYGGNDVIRINNNVDIKVIVALM
IEKYKCPIIAQQFIPNINNDKRILLLDGKPIGVFRRRILSAGEVRTNLRVGSVAEPAELS
DRDYNICLAIEDKLALKGLIFAGIDVLDGYLIEINVTSPCGVLEVNKLYNVCLEKKCWDC
FEKKFYARCGYV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcgttagttgttgcttttcagatggatagggatgtagttgttggtaaagatgtatca
gtaaaattcatacaagaagcgcaaataagaggacatactgtatttttttttactcctgat
aaattggcaataaaaaacaatattccagttgctagtgcttgtttagttactgtagaacag
gaaaaactgaagtttgagaatgtacaagagttatttcttgaagatatggatataatattt
attcgtcaaaatccaccttttgatatgcgctatattacttcgacttatattttagaaaaa
ctgacaaagccacttgtaataaatgatcctaaatttctaagggattatcctgaaaaactg
ttaccacttttattcgatgattttattccagatactctaattactgaagattattctatg
ttgcaaaatttttattatgaacataaggatattatattaaaacctctatatagttatggt
ggaaatgacgtaattaggattaataataatgttgatattaaggtaatagttgcactgatg
atagaaaagtataaatgtcctattattgctcaacaatttatacctaatattaataatgat
aaaagaattttgctattagatggtaaacctataggagtctttaggcgtagaatattatct
gctggagaggtaagaactaatttgcgagttgggtcagttgcagaacctgctgaattatca
gatcgagattataatatatgtttagcaatagaggataagttagctttgaaaggcttgata
tttgctggaatagatgtgttagatggatatttaattgaaattaatgttacgtctccttgt
ggagttttggaggttaataagttatataatgtatgtttagaaaaaaaatgttgggattgt
tttgaaaaaaagttttatgcaagatgtggttatgtatag

DBGET integrated database retrieval system