KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum6720Help
Entry
Erum6720          CDS       T00224                                 

Definition
cytochrome c-like protein
Orthology
K08738  
cytochrome c
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Erum6720
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Erum6720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1136504..1137028)
Genome map
AA seq 174 aa AA seqDB search
MDGFQLNKIFTAILFACFIVLFVSNVTDLLYNPEPHTEPVRGYKVDVEQQGLIEESAAVP
DVQVDIQALVAQANITKGKEISKKCVSCHTFEKGGANKVGPNLWHIIGNKKAHLGDAFNY
SKAMLNIGGTWEYHDLFQFLTKPQAYVKGTRMAFAGISKPQDIADLIAYMKSLE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggatggttttcaattaaataaaatatttacagctattttgtttgcatgttttatagta
ttgtttgttagtaatgtaactgacttattgtataatcctgagcctcatactgaaccagta
aggggttataaagtagatgtagagcaacagggtctgatagaagaaagtgcagctgttcct
gatgtacaagtagatatccaggctcttgtagcacaagctaatataacaaagggaaaagag
atttcaaaaaagtgtgtgtcatgtcatacttttgagaaaggtggagcaaataaagttggt
ccaaacctatggcatataatagggaacaaaaaagcacatttaggggatgctttcaattat
tcaaaggcaatgttgaatattggtggaacatgggagtatcatgacttgtttcagttttta
acaaagcctcaggcttatgttaaaggtacacgtatggcatttgctgggatttcaaagcct
caagatatagcagatttaatagcatatatgaagtctttagaatag

DBGET integrated database retrieval system