KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum6760Help
Entry
Erum6760          CDS       T00224                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eru00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Erum6760 (ruvA)
Enzymes [BR:eru01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Erum6760 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144838..1145413
Genome map
AA seq 191 aa AA seqDB search
MIGSITGNVEEIRDSYIILNVGNIGYIIYVSHKVLQTCKVGDNIKLYIETYVNRDNITQL
YGFLNRQEQDYLKMLVTINGINYKTALSILSKLSPEQIFSAVVNNDKIAFKGNGIGEKLA
GRIITELQYKINKMPIEETFSIIENDDSLAALISLGYEKLKAFNVIQEIKSKTPDASTQE
VIRKALQKLSQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgataggtagtatcacaggtaatgttgaggaaatacgtgacagctatattatactaaat
gtaggcaatataggatatattatttatgtctcacataaagtcttacagacttgtaaagta
ggagataatataaaactatatatagaaacttatgtaaatagagataacataactcaacta
tatgggtttttaaatagacaagaacaagactacttaaaaatgctggttacaataaatgga
attaattataaaacagcactttcaatattgagtaagttatcacctgaacagattttttct
gcagtagtaaacaatgataaaatagcatttaaaggaaatggtataggtgaaaaacttgca
ggacgtataataactgaactacaatataaaatcaataaaatgcctatagaagaaacattt
tcaataatagaaaatgatgattccttagctgctcttataagcttaggatatgaaaaatta
aaagctttcaatgtaatacaggaaataaaatctaaaactccagatgctagtacacaagaa
gtaataagaaaggcactacaaaaactttctcaataa

DBGET integrated database retrieval system