KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum6760Help
Entry
Erum6760          CDS       T00224                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eru03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1144838..1145413
Genome map
AA seq 191 aa AA seqDB search
MIGSITGNVEEIRDSYIILNVGNIGYIIYVSHKVLQTCKVGDNIKLYIETYVNRDNITQL
YGFLNRQEQDYLKMLVTINGINYKTALSILSKLSPEQIFSAVVNNDKIAFKGNGIGEKLA
GRIITELQYKINKMPIEETFSIIENDDSLAALISLGYEKLKAFNVIQEIKSKTPDASTQE
VIRKALQKLSQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgataggtagtatcacaggtaatgttgaggaaatacgtgacagctatattatactaaat
gtaggcaatataggatatattatttatgtctcacataaagtcttacagacttgtaaagta
ggagataatataaaactatatatagaaacttatgtaaatagagataacataactcaacta
tatgggtttttaaatagacaagaacaagactacttaaaaatgctggttacaataaatgga
attaattataaaacagcactttcaatattgagtaagttatcacctgaacagattttttct
gcagtagtaaacaatgataaaatagcatttaaaggaaatggtataggtgaaaaacttgca
ggacgtataataactgaactacaatataaaatcaataaaatgcctatagaagaaacattt
tcaataatagaaaatgatgattccttagctgctcttataagcttaggatatgaaaaatta
aaagctttcaatgtaatacaggaaataaaatctaaaactccagatgctagtacacaagaa
gtaataagaaaggcactacaaaaactttctcaataa

DBGET integrated database retrieval system