KEGG   Ehrlichia ruminantium Welgevonden (South Africa): Erum8200Help
Entry
Erum8200          CDS       T00224                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase, E2 component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eru  Ehrlichia ruminantium Welgevonden (South Africa)
Pathway
eru00020  Citrate cycle (TCA cycle)
eru00310  Lysine degradation
eru01100  Metabolic pathways
eru01110  Biosynthesis of secondary metabolites
eru01120  Microbial metabolism in diverse environments
eru01130  Biosynthesis of antibiotics
eru01200  Carbon metabolism
Module
eru_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eru_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eru00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Erum8200 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Erum8200 (sucB)
Enzymes [BR:eru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Erum8200 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 NQRA PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: CAH58555
Position
complement(1409647..1410855)
Genome map
AA seq 402 aa AA seqDB search
MSEVQVRAENLGGESILEAPIRVSVKIGDSIKQGDVLFIIETDKTSLEIVSPVDGTVSKV
FIADEEIIERDQLLCTINVGELSHIVQSQTQDPKTDNGNIINDDIQTFIQKKDAPSAVKI
MAENSIDKNQINGSGIGGRITKSDVLDHINVVSKDHSVLSEQCSITSHEKREERVKMSKI
RQVIAARLKESQNTAAILTTFNEVDMKNVMDLRVQYRETFEKKYGVKLGFMSFFIKAVVL
ALKELPVINAEISGNEIIYKHYYDIGIAVGTDKGLVVPVMRDADKMSCAELELTLASLGK
KAREGKLEVSDMAGATFTITNGGVYGSLLSTPIINPPQSGILGMHSIQKRPVVVNDNSIE
IRPMMYIALSYDHRIVDGQGAVTFLVRVKQYIEDPSRMFLEI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtacaagtaagggctgaaaatcttggtggtgagtcaatattagaagctcca
attcgagtttctgttaagattggtgatagtattaagcaaggtgatgtattgtttatcatt
gaaacggataaaacttctctcgaaattgtatctcctgtagatggaacagttagtaaagta
tttatagcagatgaagaaattatagaacgtgatcaacttttatgtacaataaatgttggt
gaattatcacatattgtccagtctcaaactcaggatcctaaaacagataatggtaatatt
attaatgatgatattcagacgtttatacagaaaaaagatgctccttctgcagtaaaaatt
atggcagaaaattcaattgataagaatcagatcaatgggtctggtattggtggaagaatt
acaaaatctgatgttttagaccacattaatgttgtttcaaaagatcatagtgtgctttct
gaacaatgtagtattacttctcatgagaagagagaagaacgtgttaagatgagtaaaatt
aggcaggtgattgctgcgaggcttaaggagtctcaaaatactgctgcgatattaactacg
tttaatgaagtggatatgaagaatgttatggatcttcgtgttcagtatagggagaccttt
gaaaaaaaatatggtgtcaaacttggatttatgtctttttttataaaagctgtagtatta
gcattaaaagaattaccagtaattaatgctgagatatctggtaatgagattatatataaa
cattattatgatataggtattgctgtagggacagacaaaggtctagttgttccagtaatg
cgtgatgctgataagatgtcttgtgctgagcttgagttaaccttagcttctttaggtaag
aaagctagggaagggaaattagaagtttcagatatggctggtgcaacttttactattact
aatggtggggtatatggttcattattatctactcctataattaatcctcctcagtctggt
attttaggtatgcactctatacaaaaacgaccagtagtagttaatgataattctatagag
attagacctatgatgtacattgcattatcttatgatcatagaattgttgatggacaaggt
gctgtaacatttttagtaagagttaaacagtatattgaagatccaagtagaatgtttcta
gaaatataa

DBGET integrated database retrieval system