KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_00260Help
Entry
ERWE_CDS_00260    CDS       T00233                                 

Gene name
xseA
Definition
hypothetical protein
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Mismatch repair
Class
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:erw03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(29874..30080)
Genome map
AA seq 68 aa AA seqDB search
MKLKFTVSEITKIFQNLVHETFNHIKVRGEISNLSQPKSGHTYFTLKDHQAVLNAVCWNN
IKFEVVVL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaatttaccgttagtgaaatcacaaaaatttttcaaaatttagtacatgaa
acgtttaatcatataaaagttagaggagaaatcagtaacctatcacaaccaaaatctgga
catacatattttacattaaaagatcatcaagcagtacttaatgcagtatgctggaataat
ataaaatttgaagtcgttgttttatga

DBGET integrated database retrieval system