KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_00260Help
Entry
ERWE_CDS_00260    CDS       T00233                                 

Gene name
xseA
Definition
hypothetical protein
Orthology
K03601  
exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:erw00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    ERWE_CDS_00260 (xseA)
Enzymes [BR:erw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     ERWE_CDS_00260 (xseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(29874..30080)
Genome map
AA seq 68 aa AA seqDB search
MKLKFTVSEITKIFQNLVHETFNHIKVRGEISNLSQPKSGHTYFTLKDHQAVLNAVCWNN
IKFEVVVL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaatttaccgttagtgaaatcacaaaaatttttcaaaatttagtacatgaa
acgtttaatcatataaaagttagaggagaaatcagtaacctatcacaaccaaaatctgga
catacatattttacattaaaagatcatcaagcagtacttaatgcagtatgctggaataat
ataaaatttgaagtcgttgttttatga

DBGET integrated database retrieval system