KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_01900Help
Entry
ERWE_CDS_01900    CDS       T00233                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
erw00020  Citrate cycle (TCA cycle)
erw00190  Oxidative phosphorylation
erw00650  Butanoate metabolism
erw01100  Metabolic pathways
erw01110  Biosynthesis of secondary metabolites
erw01120  Microbial metabolism in diverse environments
erw01130  Biosynthesis of antibiotics
erw01200  Carbon metabolism
Module
erw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
erw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
erw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:erw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ERWE_CDS_01900 (sdhD)
   00650 Butanoate metabolism
    ERWE_CDS_01900 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ERWE_CDS_01900 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAI26684
UniProt: A0A0H3LYS1
Position
309007..309357
Genome map
AA seq 116 aa AA seqDB search
MGSSVYHWLSQRLTAFIMLPFSVWFFYKFLRFLSIVCKSVSELDLSFVELNTIDVIASVC
FFIIAFYHAILGLQVILEDYVQSSVLRVSILLLIKGIVTVTLLFLIFAIFNISLNF
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
gtgggtagctcagtttatcattggttatctcaaagacttacagcatttattatgttacct
ttttctgtatggtttttttataagtttttacgttttctttctatagtgtgtaaatctgtt
tcagaacttgatttaagttttgtggaactaaatactattgatgtaattgcgtcagtatgt
ttttttattattgctttttatcatgcaattttagggttacaagttatattagaagattat
gtccaatcttctgtattaagagtatctattcttttattaataaaagggattgtaactgta
actttgttatttttaatttttgctatatttaatatctcgttaaatttctag

DBGET integrated database retrieval system