KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_02600Help
Entry
ERWE_CDS_02600    CDS       T00233                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:erw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ERWE_CDS_02600 (recR)
DNA repair and recombination proteins [BR:erw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ERWE_CDS_02600 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
422545..423132
Genome map
AA seq 195 aa AA seqDB search
MDINKLINMFAKLPNLGSSSSRRIVLYLLRNREEIMLPLASSIQELALKTKECSICFNID
VKSPCSICSDVKRDQKLLCIVEELGDLWAFEKGKIYQGVYHVLGGTLSAIYGIGPDQLNF
NNIIARIQNSGVQEVIIGISNTMDGQVTTHYITQMIKKLGVKVTRLACGIPMGGEIDYLD
EGTLSAALSSRYVIS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggatattaataaattaattaatatgtttgcaaaattaccaaatttagggtcatcttct
tctaggaggatagtactttatttacttcgtaatagagaagaaataatgttacctttagca
tcaagtattcaagagttggcgcttaaaaccaaggagtgttctatatgttttaatatagat
gtaaagtctccatgtagtatttgttctgatgttaagcgtgatcagaaattattatgtata
gttgaagaattaggagatttatgggcatttgaaaagggtaaaatatatcaaggggtatat
catgttctaggaggtactttatctgctatttatggaataggtccagatcaattgaacttt
aataatattattgcaaggatacaaaactctggggttcaggaagtgataataggtattagt
aatactatggatgggcaagttactacacattatataacacaaatgataaaaaaattagga
gttaaagttactaggttagcatgtggtattcctatgggtggagaaatagattatttagat
gaaggtacattaagtgctgcattatcttctaggtatgttatttcttag

DBGET integrated database retrieval system