KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_02900Help
Entry
ERWE_CDS_02900    CDS       T00233                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:erw00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ERWE_CDS_02900
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ERWE_CDS_02900
Enzymes [BR:erw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     ERWE_CDS_02900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481966..483351
Genome map
AA seq 461 aa AA seqDB search
MMDSSLPTIRKNKTLDSVFRVMGGMAEAIFSWVGSINKDLTRDQDIKNLYEKMKECLNPK
GGEIKARYNTISLGNLYLNLSDIGKTTFFRLLEEQFSADRNEIDEKIRDYIREIDEYEKR
KLEFELMGVLESPRFCILKQFISLPDGLKFLVDMRADVMQLRDKNQQFFSLEKDLINILS
YWFDIGLLDLHQITWDSPASLLEKLILYEAVHAISSWDDLRDRLDSDRRCFSFFHYKMLN
EPLIFVEVALVDEMASSIQTLLDSHVPPKDPKDAKVAIFYSISNTQRGLSGISLGNFLIK
RVVGKLSEEFQNIKTYATLSPIPGFVKWLTKSLSLDDIEFLNELKITMSVDEIIFHLNEK
KYSSFSQDLKGLFLKLCAYYLVESKNNDKALDPVAHFHLSNGAIIKKLNWMADTSEKGLN
CSMGIMVNYHYELSKIDDNYEDYLVNRKINCSKEVLSLLKR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
ttgatggatagttcattaccgacaataagaaaaaataagacactagatagtgtattcaga
gttatgggtggaatggctgaagctatattttcttgggttgggagtatcaataaagattta
acaagggatcaggatatcaaaaacctttatgaaaaaatgaaggaatgtcttaatccgaaa
ggtggggaaattaaggcaagatataatactatatctctcggtaatttgtaccttaattta
tctgatataggtaaaacaacgtttttcaggttattagaggagcagtttagtgctgataga
aatgagatagatgagaaaataagggattatatacgtgaaatagatgaatacgaaaagaga
aaacttgaatttgaattgatgggggtacttgaatctcctagattttgtatactaaagcag
tttatttcattaccagatggtttaaagtttcttgttgacatgagggctgatgtcatgcaa
ttacgagataaaaatcagcaatttttctctttagaaaaggatttaataaatattctttct
tattggtttgatattgggcttttggatttgcaccaaattacatgggattctcctgcttct
ttgttagaaaagcttattttatatgaggcagtacatgcaatttcttcatgggatgattta
cgtgatagattggattcagatcgtagatgtttttccttttttcactataaaatgttaaat
gaaccattgatttttgtagaagtagcacttgttgatgaaatggctagtagcatacaaaca
ttattggattctcatgttcctccgaaagatcctaaggatgccaaagtagcgattttttat
tcaatatcaaatactcaacgggggctttctgggattagtttaggtaattttctaataaag
cgtgttgtaggtaagttatcggaagagtttcaaaatataaaaacttatgcaacattgtca
ccaatacctggttttgtaaaatggcttacaaaatcgttaagtttggatgatattgaattt
ttaaatgaacttaaaattactatgtctgtagatgaaataatatttcatcttaatgagaag
aagtattctagtttttctcaagatctaaagggattatttctaaagttatgtgcttattac
ttagtagaatctaagaataatgataaagcattagatccagtagcacattttcatttaagt
aatggagcgattataaagaaattaaactggatggctgatacttcagagaaaggattaaac
tgttctatgggtattatggtaaattatcattatgagttatcaaaaatagatgataactat
gaagattatctagtaaatagaaaaattaattgttcaaaagaagtgttgtcactattgaag
cgttga

DBGET integrated database retrieval system