KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_02900Help
Entry
ERWE_CDS_02900    CDS       T00233                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:erw00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
481966..483351
Genome map
AA seq 461 aa AA seqDB search
MMDSSLPTIRKNKTLDSVFRVMGGMAEAIFSWVGSINKDLTRDQDIKNLYEKMKECLNPK
GGEIKARYNTISLGNLYLNLSDIGKTTFFRLLEEQFSADRNEIDEKIRDYIREIDEYEKR
KLEFELMGVLESPRFCILKQFISLPDGLKFLVDMRADVMQLRDKNQQFFSLEKDLINILS
YWFDIGLLDLHQITWDSPASLLEKLILYEAVHAISSWDDLRDRLDSDRRCFSFFHYKMLN
EPLIFVEVALVDEMASSIQTLLDSHVPPKDPKDAKVAIFYSISNTQRGLSGISLGNFLIK
RVVGKLSEEFQNIKTYATLSPIPGFVKWLTKSLSLDDIEFLNELKITMSVDEIIFHLNEK
KYSSFSQDLKGLFLKLCAYYLVESKNNDKALDPVAHFHLSNGAIIKKLNWMADTSEKGLN
CSMGIMVNYHYELSKIDDNYEDYLVNRKINCSKEVLSLLKR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
ttgatggatagttcattaccgacaataagaaaaaataagacactagatagtgtattcaga
gttatgggtggaatggctgaagctatattttcttgggttgggagtatcaataaagattta
acaagggatcaggatatcaaaaacctttatgaaaaaatgaaggaatgtcttaatccgaaa
ggtggggaaattaaggcaagatataatactatatctctcggtaatttgtaccttaattta
tctgatataggtaaaacaacgtttttcaggttattagaggagcagtttagtgctgataga
aatgagatagatgagaaaataagggattatatacgtgaaatagatgaatacgaaaagaga
aaacttgaatttgaattgatgggggtacttgaatctcctagattttgtatactaaagcag
tttatttcattaccagatggtttaaagtttcttgttgacatgagggctgatgtcatgcaa
ttacgagataaaaatcagcaatttttctctttagaaaaggatttaataaatattctttct
tattggtttgatattgggcttttggatttgcaccaaattacatgggattctcctgcttct
ttgttagaaaagcttattttatatgaggcagtacatgcaatttcttcatgggatgattta
cgtgatagattggattcagatcgtagatgtttttccttttttcactataaaatgttaaat
gaaccattgatttttgtagaagtagcacttgttgatgaaatggctagtagcatacaaaca
ttattggattctcatgttcctccgaaagatcctaaggatgccaaagtagcgattttttat
tcaatatcaaatactcaacgggggctttctgggattagtttaggtaattttctaataaag
cgtgttgtaggtaagttatcggaagagtttcaaaatataaaaacttatgcaacattgtca
ccaatacctggttttgtaaaatggcttacaaaatcgttaagtttggatgatattgaattt
ttaaatgaacttaaaattactatgtctgtagatgaaataatatttcatcttaatgagaag
aagtattctagtttttctcaagatctaaagggattatttctaaagttatgtgcttattac
ttagtagaatctaagaataatgataaagcattagatccagtagcacattttcatttaagt
aatggagcgattataaagaaattaaactggatggctgatacttcagagaaaggattaaac
tgttctatgggtattatggtaaattatcattatgagttatcaaaaatagatgataactat
gaagattatctagtaaatagaaaaattaattgttcaaaagaagtgttgtcactattgaag
cgttga

DBGET integrated database retrieval system