KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_04170Help
Entry
ERWE_CDS_04170    CDS       T00233                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
erw00010  Glycolysis / Gluconeogenesis
erw00051  Fructose and mannose metabolism
erw00562  Inositol phosphate metabolism
erw01100  Metabolic pathways
erw01110  Biosynthesis of secondary metabolites
erw01120  Microbial metabolism in diverse environments
erw01130  Biosynthesis of antibiotics
erw01200  Carbon metabolism
erw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:erw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ERWE_CDS_04170 (tpiA)
   00051 Fructose and mannose metabolism
    ERWE_CDS_04170 (tpiA)
   00562 Inositol phosphate metabolism
    ERWE_CDS_04170 (tpiA)
Enzymes [BR:erw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ERWE_CDS_04170 (tpiA)
Exosome [BR:erw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ERWE_CDS_04170 (tpiA)
  Exosomal proteins of bladder cancer cells
   ERWE_CDS_04170 (tpiA)
  Exosomal proteins of melanoma cells
   ERWE_CDS_04170 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAI26911
UniProt: A0A0H3M641
Position
687112..687834
Genome map
AA seq 240 aa AA seqDB search
MSLLIVANWKMHGDFFTFSSFTKELSNRLINIEDKVKVVLCPPFIALSTYVNCPHNIKFG
GQNCCYVSSGKYTGEISASMLYNSGCSYVIVGHSERRSTFHETDHDVRLKAECAIESGLI
PIICVGETLLDRENGMLKDTLLSQCSKSFPKNGKFIIAYEPVWAIGNNKIPSTDVIIEAL
EIIRSYDYVSDIIYGGAVNHTNVGDIVSINQLSGVLVGSASLDMESFFNIICSAINVGQS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcattactcatcgttgctaactggaagatgcatggtgatttttttactttttcttcg
tttacaaaggagcttagtaaccgtttaattaatatagaagataaagtaaaggtagtatta
tgcccaccatttattgcgttatctacttatgttaattgtccacataatattaagtttggt
ggacagaactgttgttatgtatctagtgggaagtacactggagaaattagtgctagtatg
ttatataactctggatgtagttatgtaatagtgggtcactctgaaaggaggagtacgttt
catgaaactgatcatgatgttaggttaaaagctgaatgtgcgatcgaatcaggattaata
ccaattatttgtgttggagaaactttactagatagggaaaatggtatgctaaaagatact
ttattaagtcaatgtagtaaatcttttcctaaaaatggtaagtttatcatagcatatgag
ccagtatgggcaatagggaacaataaaataccttctactgatgtaataatagaagcttta
gagattattaggtcatatgattatgtatctgatatcatatatggtggagcagtaaatcat
actaatgtaggtgatattgtcagtataaatcaattatctggtgttttagttggtagtgct
agtttagatatggagagtttttttaatataatatgtagtgctataaatgtggggcaaagt
taa

DBGET integrated database retrieval system