KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_04420Help
Entry
ERWE_CDS_04420    CDS       T00233                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:erw00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:erw00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(714011..714931)
Genome map
AA seq 306 aa AA seqDB search
MNMLLEINDLNSYDIEFIFDTAIQHFNNSNVSNNSLYGKTIVNLFFESSTRTLSSFEISA
KSLGAHTVTINVSTSSMNKGESIIDTVLNINAMNPDLIIIRSQYSQFIKEISKYLPNCHI
INAGDGHHEHPTQALIDYCTIRYIKGKIHNLNISICGDILHSRVARSNIRLLSRYGANIS
IVAPPTLICNLKGVSHIHHNFVEGISDSDVIMLLRLQKERMTNFTISSEEEYAYLYMLNY
ENLSYARSDVIVMHPGPTNKGVEISHYVAEKKSIILLQVKMGVAVRKAILEYLLCHKLVK
DMGNIT
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgttattagaaataaatgatctaaattcttatgatatagaattcatttttgac
actgcaatacaacattttaataacagcaatgttagtaacaattccttatatggaaaaaca
attgttaatttattttttgaaagttcaacccgtactttatcttcttttgaaatttctgca
aagtctttaggagcacatactgttactataaatgtaagtacatcatctatgaataaagga
gaaagcattatagatactgtgttaaatataaatgcaatgaatcctgatctaattattatc
aggtcacaatacagtcaatttataaaagaaatatcaaaatatttaccaaattgtcatatt
atcaatgcaggagatggacaccatgaacacccaacacaagcattaatagattattgtact
atacgttatattaaaggaaaaattcataatttaaatatatctatatgtggtgatatatta
catagtagagttgcaagatcaaacatcagattattatcaagatacggggctaatatatct
atagttgctccaccaacattaatttgtaatttgaaaggagtatcgcatatacatcacaac
tttgttgaaggaattagtgattcagatgttattatgctattaaggctacaaaaagaacgt
atgactaattttactatttcttcagaagaggaatatgcatatctttatatgttaaattat
gaaaacctttcttatgcaaggtcagatgtgatagttatgcatccaggacctacaaataag
ggtgtagaaatatctcattatgtagcagaaaaaaaatctataattctactgcaagtaaaa
atgggtgtagcagtacgaaaagcaatattagagtacttactgtgtcataaattagttaaa
gacatgggtaatattacataa

DBGET integrated database retrieval system