KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_05640Help
Entry
ERWE_CDS_05640    CDS       T00233                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:erw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
907801..908529
Genome map
AA seq 242 aa AA seqDB search
MKSLLVTRPQEDSIIIKETLTNLGFNIYIEPMFSIKYLPVKLNLEYFDLIISTSKHSIIA
LSKISKNRTQPIITVGDNTKQVAEKLGFSSVTSLNGNIHDIISYIHNNSHLKFLYIRGQE
ITYDLKEIFSNNTIKFYEIILYSTIDKQSLSNHCYNLLFHNRISGILFYSSRTATIFMDL
IKKHNIGHKTSSITVYAMSQKIAETVNNISWKSIKTSDKPTNKSLISLISSDMKIIKEST
LD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctttattagttacacgacctcaggaagactctataataataaaagaaacctta
acaaacttaggctttaatatttacatagagcctatgttctcaataaaatatttacctgta
aaacttaatttagaatatttcgatttaattatatctacaagcaagcacagtattattgca
ttatctaaaattagtaaaaatcgcactcaacccataatcaccgtaggcgataacacaaag
caagttgcagaaaaattaggcttttcatcagtcacatcacttaacggtaatattcatgac
attatatcatacatacacaataattctcatctaaaatttttatatatcagaggacaagaa
ataacatatgacctaaaagagatttttagtaataatactattaaattttatgaaattata
ctatattcgacaatagataaacagtctttaagtaatcattgctataacttactctttcat
aatagaatttctgggatattattctactcttcaagaactgccaccatatttatggattta
ataaaaaagcacaatataggtcataaaacaagcagcataactgtatatgctatgagtcaa
aaaatcgcagaaactgtaaataatatatcctggaaaagtataaaaacttctgataaaccg
actaataaatcactaatttcattaatatcttctgatatgaaaattatcaaagaatccaca
ttagactaa

DBGET integrated database retrieval system