KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_05640Help
Entry
ERWE_CDS_05640    CDS       T00233                                 

Definition
hypothetical protein
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:erw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ERWE_CDS_05640
Enzymes [BR:erw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ERWE_CDS_05640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
907801..908529
Genome map
AA seq 242 aa AA seqDB search
MKSLLVTRPQEDSIIIKETLTNLGFNIYIEPMFSIKYLPVKLNLEYFDLIISTSKHSIIA
LSKISKNRTQPIITVGDNTKQVAEKLGFSSVTSLNGNIHDIISYIHNNSHLKFLYIRGQE
ITYDLKEIFSNNTIKFYEIILYSTIDKQSLSNHCYNLLFHNRISGILFYSSRTATIFMDL
IKKHNIGHKTSSITVYAMSQKIAETVNNISWKSIKTSDKPTNKSLISLISSDMKIIKEST
LD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctttattagttacacgacctcaggaagactctataataataaaagaaacctta
acaaacttaggctttaatatttacatagagcctatgttctcaataaaatatttacctgta
aaacttaatttagaatatttcgatttaattatatctacaagcaagcacagtattattgca
ttatctaaaattagtaaaaatcgcactcaacccataatcaccgtaggcgataacacaaag
caagttgcagaaaaattaggcttttcatcagtcacatcacttaacggtaatattcatgac
attatatcatacatacacaataattctcatctaaaatttttatatatcagaggacaagaa
ataacatatgacctaaaagagatttttagtaataatactattaaattttatgaaattata
ctatattcgacaatagataaacagtctttaagtaatcattgctataacttactctttcat
aatagaatttctgggatattattctactcttcaagaactgccaccatatttatggattta
ataaaaaagcacaatataggtcataaaacaagcagcataactgtatatgctatgagtcaa
aaaatcgcagaaactgtaaataatatatcctggaaaagtataaaaacttctgataaaccg
actaataaatcactaatttcattaatatcttctgatatgaaaattatcaaagaatccaca
ttagactaa

DBGET integrated database retrieval system