KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_07090Help
Entry
ERWE_CDS_07090    CDS       T00233                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:erw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ERWE_CDS_07090 (ruvA)
Enzymes [BR:erw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ERWE_CDS_07090 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1123437..1124012
Genome map
AA seq 191 aa AA seqDB search
MIGSITGNVEEIRDSYIILNVGNIGYIIYVSHKVLQTCKVGDNIKLYIETYVNRDNITQL
YGFLNRQEQDYLKMLVTINGINYKTALSILSKLSPEQIFSAVVNNDKIAFKGNGIGEKLA
GRIITELQYKINKMPIEETFSIIENDDSLAALISLGYEKLKAFNVIQEIKSKTPDASTQE
VIRKALQKLSQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
ttgataggtagtatcacaggtaatgttgaggaaatacgtgacagctatattatactaaat
gtaggcaatataggatatattatttatgtctcacataaagtcttacagacttgtaaagta
ggagataatataaaactatatatagaaacttatgtaaatagagataacataactcaacta
tatgggtttttaaatagacaagaacaagactacttaaaaatgctggttacaataaatgga
attaattataaaacagcactttcaatattgagtaagttatcacctgaacagattttttct
gcagtagtaaacaatgataaaatagcatttaaaggaaatggtataggtgaaaaacttgca
ggacgtataataactgaactacaatataaaatcaataaaatgcctatagaagaaacattt
tcaataatagaaaatgatgattccttagctgctcttataagcttaggatatgaaaaatta
aaagctttcaatgtaatacaggaaataaaatctaaaactccagatgctagtacacaagaa
gtaataagaaaggcactacaaaaactttctcaataa

DBGET integrated database retrieval system