KEGG   Ehrlichia ruminantium Welgevonden (France): ERWE_CDS_08690Help
Entry
ERWE_CDS_08690    CDS       T00233                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase subunit
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
erw  Ehrlichia ruminantium Welgevonden (France)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:erw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ERWE_CDS_08690 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ERWE_CDS_08690 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    ERWE_CDS_08690 (sucB)
Enzymes [BR:erw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     ERWE_CDS_08690 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1387659..1388867)
Genome map
AA seq 402 aa AA seqDB search
MSEVQVRAENLGGESILEAPIRVSVKIGDSIKQGDVLFIIETDKTSLEIVSPVDGTVSKV
FIADEEIIERDQLLCTINVGELSHIVQSQTQDPKTDNGNIINDDIQTFIQKKDAPSAVKI
MAENSIDKNQINGSGIGGRITKSDVLDHINVVSKDHSVLSEQCSITSHEKREERVKMSKI
RQVIAARLKESQNTAAILTTFNEVDMKNVMDLRVQYRETFEKKYGVKLGFMSFFIKAVVL
ALKELPVINAEISGNEIIYKHYYDIGIAVGTDKGLVVPVMRDADKMSCAELELTLASLGK
KAREGKLEVSDMAGATFTITNGGVYGSLLSTPIINPPQSGILGMHSIQKRPVVVNDNSIE
IRPMMYIALSYDHRIVDGQGAVTFLVRVKQYIEDPSRMFLEI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtacaagtaagggctgaaaatcttggtggtgagtcaatattagaagctcca
attcgagtttctgttaagattggtgatagtattaagcaaggtgatgtattgtttatcatt
gaaacggataaaacttctctcgaaattgtatctcctgtagatggaacagttagtaaagta
tttatagcagatgaagaaattatagaacgtgatcaacttttatgtacaataaatgttggt
gaattatcacatattgtccagtctcaaactcaggatcctaaaacagataatggtaatatt
attaatgatgatattcagacgtttatacagaaaaaagatgctccttctgcagtaaaaatt
atggcagaaaattcaattgataagaatcagatcaatgggtctggtattggtggaagaatt
acaaaatctgatgttttagaccacattaatgttgtttcaaaagatcatagtgtgctttct
gaacaatgtagtattacttctcatgagaagagagaagaacgtgttaagatgagtaaaatt
aggcaggtgattgctgcgaggcttaaggagtctcaaaatactgctgcgatattaactacg
tttaatgaagtggatatgaagaatgttatggatcttcgtgttcagtatagggagaccttt
gaaaaaaaatatggtgtcaaacttggatttatgtctttttttataaaagctgtagtatta
gcattaaaagaattaccagtaattaatgctgagatatctggtaatgagattatatataaa
cattattatgatataggtattgctgtagggacagacaaaggtctagttgttccagtaatg
cgtgatgctgataagatgtcttgtgctgagcttgagttaaccttagcttctttaggtaag
aaagctagggaagggaaattagaagtttcagatatggctggtgcaacttttactattact
aatggtggggtatatggttcattattatctactcctataattaatcctcctcagtctggt
attttaggtatgcactctatacaaaaacgaccagtagtagttaatgataattctatagag
attagacctatgatgtacattgcattatcttatgatcatagaattgttgatggacaaggt
gctgtaacatttttagtaagagttaaacagtatattgaagatccaagtagaatgtttcta
gaaatataa

  All links  
No link information was found.   
DBGET integrated database retrieval system