KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00054Help
Entry
ESA_00054         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESA_00054
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ESA_00054
Enzymes [BR:esa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ESA_00054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
33259..34566
Genome map
AA seq 435 aa AA seqDB search
MTTTRTQQIQQLEQEWTNPRWEGIRRPYSAQDVVKLRGSVNPECTLAQLGAARMWRLLHG
ESKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLAASMYPDQSLYPANSVPA
VVERINNTFRRADQIQWAAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLLIARTDADAAD
LITSDCDPYDSEFITGERTSEGFFRTRAGVEQAISRGLAYAPYADLVWCETSTPDLDQAR
RFAEAIHARFPGKLLAYNCSPSFNWKKKLDDKTIASFQEELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMRHYVEKVQQPEFAAGKEGYTFVSHQQEVGTGYFDNVTTIIQGGV
SSVTALTGSTEEAQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaacacgtacccaacagattcagcagttagagcaggaatggacaaacccgcgc
tgggagggcattcgccgcccttatagcgcgcaggatgtggtgaaattacgcggttcggtc
aatccggaatgcacgctggcgcagcttggcgcggcaagaatgtggcgtctgctgcatggc
gagtcgaaaaagggctacgtcaacagcctgggcgcgctgaccggcgggcaggcattgcag
caggcgaaagcggggatcgaggccatctatctctccggctggcaggtcgcggcagacgcc
aaccttgccgccagcatgtatccggaccagtcgctctatccggcgaactccgtacctgcg
gtggttgagcggatcaacaacacgtttcgtcgcgccgatcagatccagtgggctgcgggc
attgagcctggcgatccgcgttatgtcgattatttcctgccgatcgtggccgatgccgag
gcgggcttcggcggcgtgctcaatgcctttgagctgatgaaagcgatgattgaggccggt
gccgcggcggttcactttgaagatcagctcgcctcggtgaaaaagtgcggccatatgggc
ggcaaagtgctggtgcccacgcaggaagctatccagaagctggttgcggcccggctcgcg
gcagacgttatgggcgttccgacgttgctgattgcgcgcaccgacgccgatgcggcggat
ctcatcacctccgactgcgatccgtatgacagcgaattcattaccggcgagcgtaccagc
gaaggtttcttccgtacccgcgcgggcgtcgagcaggcgatcagccgcgggctcgcctat
gcgccgtatgcggatctggtgtggtgcgaaacctccacgccggatctcgaccaggcgcga
cgcttcgccgaagctatccacgcgcgcttccccggcaagctgctggcatataactgctcg
ccgtcgttcaactggaagaaaaagctcgatgacaaaaccatcgcgtctttccaggaggag
ctctcggcgatggggtacaaataccagttcattacgctcgcgggcattcacagcatgtgg
ttcaacatgtttgatctcgctcacgcctacgcgcagggcgaagggatgcggcattacgtc
gagaaagtgcagcagccggaatttgccgctggcaaagagggctacacctttgtatcgcac
cagcaggaggtgggcacgggttactttgataatgtcacgaccattatccagggcggcgtg
tcatccgtgacggcgttaaccggctcgaccgaagaagcgcagttctga

DBGET integrated database retrieval system