KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00403Help
Entry
ESA_00403         CDS       T00586                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ESA_00403
Enzymes [BR:esa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ESA_00403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379484..380404
Genome map
AA seq 306 aa AA seqDB search
MNTLGHQYDNSLVSNAFGFLRLPLNFMPYDSDAEWVITGIPFDMATSGRSGSRFGPAAIR
QVSTNLAWEGNRFPWNFDMRKRLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPNEGLIDPTR
SVQIGIRTEFDKDNGFTVLDAPQVNDRTVDDVVAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRALKLLRGIQDLNIVGMDIVEVAPAYDQSDITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccttaggccatcagtacgacaactccctggtttccaacgcctttggtttttta
cgcctgccgttgaatttcatgccgtatgacagcgacgccgagtgggtgatcaccggtatt
ccgtttgatatggccacctctggccgttcgggcagccgcttcggacctgccgctattcgt
caggtatccaccaacctcgcgtgggaaggcaaccgcttcccgtggaacttcgatatgcgt
aagcgcctgaacgtcgtggactgcggcgatctggtttacgcgttcggcgatgcgcgcgag
atgagcgagaaactccaggcgcacgcggaaaaactgctggcggccggtaagcgtatgctc
tctttcggcggtgaccacttcgtgacgctgccgctgctgcgcgcccacgcgaagcacttc
ggtaaaatggcgctggtgcatttcgacgcgcataccgatacctacgccaacggctgtgaa
tttgaccacggcaccatgttctacaccgcgccgaacgaaggcctgatcgatccgacccgc
tcggtgcagattggtattcgtaccgagttcgacaaagacaacggctttaccgtgctggac
gcgccgcaggtgaacgaccgcaccgttgacgatgtggtggcacaggtgaaacagattgtc
ggcgacatgccggtatacctgacgttcgacatcgactgcctggatccggcgttcgcaccg
ggcaccggcacgccggtgattggcggcctgacctccgatcgcgcgctgaaactgctgcgc
ggcattcaggatctgaacatcgtcggtatggatattgtggaagtggcaccggcatacgac
cagtctgatatcaccgcgctggccgctgcgacgctggcgctggaaatgctctacatccag
gcggcgaaaaaaggcgagtaa

DBGET integrated database retrieval system