KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00438Help
Entry
ESA_00438         CDS       T00586                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Brite
Enzymes [BR:esa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ESA_00438
Secretion system [BR:esa02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ESA_00438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
413645..414364
Genome map
AA seq 239 aa AA seqDB search
MKKTIALLSVTLAAFSGFAQADDAAIKQSLTKLGVANAEIQPSPLAGMKTVLTESGVIYV
TEDGKHIIQGPLYDVSGGQPVNVTNQMLMTKLNALEKEMIVYKAPQEKHVITVFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRQGPRSETAKDMQAIWCAKDRNKAFDNAMSGGKVE
AASCDVDTAKHYELGVQFGVQGTPAIVLSNGAMVPGYQGPKEMKAFLDEHQKQLQASGK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaactattgcgctgctctccgttacgctggcggctttttcaggatttgcccag
gcggatgacgcagccattaagcagtcgctcaccaaactcggtgtagcgaacgctgaaatt
cagccgtctccgctggcaggcatgaaaaccgtactgaccgaaagcggcgttatctatgtg
actgaagacggcaaacatatcattcagggcccgctgtatgacgtcagcggcggccagccg
gtcaacgtgaccaatcagatgctgatgaccaaactcaacgcgctcgaaaaagagatgatt
gtttataaagcgccgcaggaaaaacatgtcatcaccgtctttaccgatatcacctgtggc
tattgccataagctgcacgaagagatgaaagactataacgcgctgggcatcacggtgcgc
tacctggctttcccgcgtcaggggccgcgcagcgaaacagcgaaagatatgcaggctatc
tggtgcgcgaaagatcgtaataaagccttcgataacgcgatgagcggcggcaaagttgaa
gcggccagttgcgacgtcgacaccgcgaaacattacgagctcggcgtgcagtttggcgtc
cagggcacaccggcgatcgtgctgagcaatggcgcgatggtgccgggctatcaggggcca
aaagagatgaaagcttttcttgatgagcatcagaaacagcttcaggcgagcggaaagtaa

DBGET integrated database retrieval system