KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00490Help
Entry
ESA_00490         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:esa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ESA_00490
Enzymes [BR:esa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ESA_00490
DNA repair and recombination proteins [BR:esa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ESA_00490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
467725..469560
Genome map
AA seq 611 aa AA seqDB search
MKMHQLIQQAVVQKLLRPLDAQFAMMVASDDEPAVMLAASLVSRDAGEGHVCLPLSRLCA
THCFAGRHDEMAQTLFEAAGNPDDWRSLLLASPAVSEDDAPTPLKLIGERLYLNRMWRHE
RAVAAFFRERNHSIELEEARLSAVLEALFGPPGDEVDWQKVAAAVALTRRISVISGGPGT
GKTTTVAKLLAAMVQLSEEKLPRIRLAAPTGKAAARLTESLGAALRRLPLSDAQKNALPE
EASTLHRLLGAQPGSQRLRYHEGNPLHLDVLVVDEASMIDLPMMARLIAALPDHARVIFL
GDRDQLASVEAGAVLGDICHYVNHGFTTERATELARITGCHINGGEPHPAGALRDCLCLL
QKSYRFGSDSGIGQLAFAVNRSDHRAARATFSRGFDDIACKTLAGNDDYAQMIDETLAGY
ERFLTLVRERAEPEAILAAFSEFQMLCALREGPFGVAGLNERVEHALAQRRLIRRTPLSR
WYEGRPVMISRNDSALGLFNGDIGVALDRGDGLRVWFPMPGGKLKPVVPSRLPDNDTAWA
MTVHKSQGSEFDHAALLLPGQFAPVVTRELVYTAITRARRRLSLYADERVLEMAIATRTE
RRSGLMACFEQ
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcatcaactgatccagcaggccgtagtgcaaaagcttctgcgcccgctggat
gcccagttcgcgatgatggtggcaagcgatgatgaaccggcggtgatgctcgccgcctcg
ctggtgagccgcgacgccggtgaaggccacgtctgtctgccgctctcccggctgtgtgcg
acgcactgcttcgccgggcgtcacgatgaaatggcgcaaacgctgtttgaggcggcgggc
aatccggacgactggcgctcgctgttactggcatcgcctgcggtgagtgaggacgacgcg
ccgacgccgctgaagctcatcggcgagcgtttgtatctgaaccgtatgtggcgtcatgag
agggcggtcgcggcgttctttcgcgagcgtaaccatagtattgaactggaagaagcgcgc
ctgagcgcggtactggaggcgctttttgggccaccaggcgatgaagtggactggcagaaa
gtggcggcggcagtcgcgctcacccggcgcatctcggtgatttccggcgggccgggcacc
gggaaaaccaccacggtggcgaaactgctggcggccatggtgcagctctcggaagagaaa
ctgccgcgtatccgccttgccgcgccgaccggtaaagccgcggcgcgcctgacggaatcg
ctcggtgctgcgctgcgtcgtttgccactgagcgacgcgcagaaaaacgcgctgccggaa
gaagccagcacgctgcaccgcctgctgggtgcgcagccgggcagccagcgtctgcgctac
cacgaaggtaacccgctgcatctggatgttctggtggtggatgaggcttcgatgatagac
ctgccgatgatggcgcggcttatcgcggcgctgccggaccatgcgcgggtgattttttta
ggcgatcgcgatcagctggcgtccgtggaagcgggcgcggtgctcggtgatatctgccac
tacgtgaaccacggttttaccactgaacgcgccaccgagcttgcccgcatcacggggtgt
cacattaacggcggcgagcctcatccggcaggcgcgctgcgcgactgcctgtgcctgctg
cagaaaagctatcgttttggcagcgattccggcatcggccagctcgcgtttgctgttaat
cgcagcgatcatcgcgccgccagagcgacgtttagccgaggatttgacgatatcgcctgc
aaaacgctggcgggtaacgacgattacgcacagatgattgacgagacgctggcaggctac
gagcggttcttaacgctggtccgcgagcgtgccgagccggaggccattcttgcggccttc
agcgaattccagatgctctgcgcgctgcgtgaagggccgttcggcgtcgccgggcttaac
gagcgtgtggaacatgcgctggcgcagcggcggctgattcgtcgcacgccgctgtcgcgc
tggtatgaagggcggccggtgatgatttcgcgcaacgacagcgcgctggggctgtttaac
ggcgatatcggcgtggcgctggatcgtggcgatggcctgcgcgtctggttcccgatgccc
ggcggcaaactgaaacccgtcgtgccaagccgcttgccggataatgacaccgcgtgggca
atgacggtgcataaatcacagggttcggagttcgatcatgcggcgctgctcctgccgggg
cagttcgcgccggtggtcacgcgagagctggtctatacggcgattacgcgcgcgcggcga
cggttgtcgctgtatgcggatgagcgggtgctggagatggccatcgcgaccagaacggaa
cggcgcagcggcctgatggcctgctttgaacaataa

DBGET integrated database retrieval system