KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00852Help
Entry
ESA_00852         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00010  Glycolysis / Gluconeogenesis
esa00052  Galactose metabolism
esa00500  Starch and sucrose metabolism
esa00520  Amino sugar and nucleotide sugar metabolism
esa00521  Streptomycin biosynthesis
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
esa01130  Biosynthesis of antibiotics
esa01200  Carbon metabolism
Module
esa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
esa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_00852
   00052 Galactose metabolism
    ESA_00852
   00500 Starch and sucrose metabolism
    ESA_00852
   00520 Amino sugar and nucleotide sugar metabolism
    ESA_00852
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ESA_00852
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ESA_00852
Enzymes [BR:esa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ESA_00852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ABU76123
UniProt: A7MP52
Position
822645..823610
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVDSGEILKAKTYSGLDYPSLEAVVRVYLEEHNATVTDGC
IAIACPITGDWVAMTNHVWAFSVAEMKKNLGFDHLEIINDFTAVSMAIPMLKTDHLIQFG
GGEPQPNKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEQLRAE
VGHVSAERVLSGPGLVNLYRAIVKADGRLPDNLRPKDITERALDDSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLDFFTSSGFRGGFEDKGRFKSYVQDIPVYLIV
HDQPGLLGAGAHLRQTLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatatgctttggtgggagacgtaggcggcaccaacgcacgcttagcgctgtgc
gacgtagacagcggcgagatactcaaggcgaaaacctattctggccttgattatccgagc
ctggaagcggtggtgcgggtgtatctggaagagcataacgccacggtgacggatggctgt
atcgccatcgcatgcccgattaccggcgactgggtggcgatgaccaaccacgtatgggcg
ttttctgtcgccgaaatgaaaaagaatctcggcttcgatcatctggaaattattaacgat
ttcaccgccgtgtctatggcgatcccgatgctcaaaaccgaccatctgatccagtttggc
ggcggcgaaccgcagcccaataaaccgatcgccgtttatggcgcgggcaccgggcttggt
gtggcgcacctcgtgcatgtcgataaacgctgggtcagcctgccgggcgagggcggtcac
gtcgatttcgcgcctaacagcgaagaagaagcgattattcttgagcagctgcgcgccgaa
gtcgggcacgtctccgccgagcgcgtgctctcagggccggggcttgtgaatctttaccgc
gccattgttaaagccgatggccgtctgccggataatttgcgtccgaaagacatcaccgaa
cgcgcgctggatgacagctgcaccgactgccgtcgcgcgctgtcgctcttttgcgtcatc
atgggccgtttcggcggcaacctggcgctgacgctcggcactttcggcggcgtctatatc
gcaggcggtatcgtgccgcgtttcctggatttcttcacctccagcggtttccgcggcggg
tttgaagataaaggccgctttaaatcttatgtgcaggatattccggtctatctgattgtt
cacgaccagccggggctgctcggcgcgggcgcgcatctgcgccagacgctcggacagatc
ctctga

DBGET integrated database retrieval system