KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00852Help
Entry
ESA_00852         CDS       T00586                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESA_00852 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_00852 (glk)
   00052 Galactose metabolism
    ESA_00852 (glk)
   00500 Starch and sucrose metabolism
    ESA_00852 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ESA_00852 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ESA_00852 (glk)
   00524 Butirosin and neomycin biosynthesis
    ESA_00852 (glk)
Enzymes [BR:esa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ESA_00852 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
822645..823610
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVDSGEILKAKTYSGLDYPSLEAVVRVYLEEHNATVTDGC
IAIACPITGDWVAMTNHVWAFSVAEMKKNLGFDHLEIINDFTAVSMAIPMLKTDHLIQFG
GGEPQPNKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEQLRAE
VGHVSAERVLSGPGLVNLYRAIVKADGRLPDNLRPKDITERALDDSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLDFFTSSGFRGGFEDKGRFKSYVQDIPVYLIV
HDQPGLLGAGAHLRQTLGQIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatatgctttggtgggagacgtaggcggcaccaacgcacgcttagcgctgtgc
gacgtagacagcggcgagatactcaaggcgaaaacctattctggccttgattatccgagc
ctggaagcggtggtgcgggtgtatctggaagagcataacgccacggtgacggatggctgt
atcgccatcgcatgcccgattaccggcgactgggtggcgatgaccaaccacgtatgggcg
ttttctgtcgccgaaatgaaaaagaatctcggcttcgatcatctggaaattattaacgat
ttcaccgccgtgtctatggcgatcccgatgctcaaaaccgaccatctgatccagtttggc
ggcggcgaaccgcagcccaataaaccgatcgccgtttatggcgcgggcaccgggcttggt
gtggcgcacctcgtgcatgtcgataaacgctgggtcagcctgccgggcgagggcggtcac
gtcgatttcgcgcctaacagcgaagaagaagcgattattcttgagcagctgcgcgccgaa
gtcgggcacgtctccgccgagcgcgtgctctcagggccggggcttgtgaatctttaccgc
gccattgttaaagccgatggccgtctgccggataatttgcgtccgaaagacatcaccgaa
cgcgcgctggatgacagctgcaccgactgccgtcgcgcgctgtcgctcttttgcgtcatc
atgggccgtttcggcggcaacctggcgctgacgctcggcactttcggcggcgtctatatc
gcaggcggtatcgtgccgcgtttcctggatttcttcacctccagcggtttccgcggcggg
tttgaagataaaggccgctttaaatcttatgtgcaggatattccggtctatctgattgtt
cacgaccagccggggctgctcggcgcgggcgcgcatctgcgccagacgctcggacagatc
ctctga

DBGET integrated database retrieval system