KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_00882Help
Entry
ESA_00882         CDS       T00586                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ESA_00882 (fadJ)
   01212 Fatty acid metabolism
    ESA_00882 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ESA_00882 (fadJ)
   00650 Butanoate metabolism
    ESA_00882 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    ESA_00882 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    ESA_00882 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ESA_00882 (fadJ)
   00310 Lysine degradation
    ESA_00882 (fadJ)
   00380 Tryptophan metabolism
    ESA_00882 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ESA_00882 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ESA_00882 (fadJ)
   00281 Geraniol degradation
    ESA_00882 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ESA_00882 (fadJ)
Enzymes [BR:esa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ESA_00882 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ESA_00882 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ESA_00882 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
849786..851939
Genome map
AA seq 717 aa AA seqDB search
MESTSAFNLQMRPDNVAVVTIDVPGEKMNTLKAEFARDVRAIVKTLRENRDLAGVVFISA
KPDNFIAGADINMIAHCQSAQEAEALASQGQQIMAEIRALPVHVVAAIHGACLGGGLELA
LACHSRICTDDVKTLLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILAGKQLRPRQAL
KAGLVDDVVPQSILLEAAAELAKKRRPAPRRLPVRERLLAGPIGRALLFRMVTQKTHQKT
HGNYPAAQRIIDVVRTGLEQGSASGYQAEARAFGELAMTPESAALRGLFFATTELKKETG
SEAAPRALHSVGVLGGGLMGGGIAYVTATKARLPVRIKDISEKGINHALKYSWDLLEKKV
RRRHLRASERDAQMALISASTDYRGFHQRDIVVEAVFEDLTLKQNMVAEIEAHTAPHTIF
ASNTSSLPIGDIAAGATRPEQVIGLHYFSPVDKMPLVEVIPHAGTSAETIATTVQLAKKQ
GKTPIVVADCAGFYVNRILAPYINEAMRCLMEGESIEKIDEALVKRGFPVGPIQLLDEVG
IDVGTKIMPVLERAYGPRFSAPGDAVAAILNDDRKGRKNGRGFYLYPAKGRKSKKQVDPA
VYGLIGVKPGGKLSGEEIAERCVMMMLNEAARCLDEGVVRSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAAAMATTLTRLATRYGDRFTPCDRLLRMAQTGQTFWLAGNLQAEMTV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgacatccgcatttaatttacagatgcgcccggacaatgttgcggtggtcacc
atcgacgtgccgggcgagaaaatgaacacgctgaaggcggagtttgcccgcgacgtccgc
gcgattgtcaaaacgctgcgggaaaaccgcgatctcgcgggcgtggtatttatctccgcc
aagccggataactttatcgccggtgcggatatcaacatgatcgcgcactgccagagcgcg
caggaggccgaagcgctggcaagccagggccagcagatcatggcggagatccgcgcgctg
ccggtgcatgtggtcgcggccattcatggcgcgtgccttggcggcgggctggagctggcg
cttgcctgccacagccgcatctgtaccgatgatgtgaaaacgctgctcgggctgccggaa
gtgcagcttgggctgctgccgggctccggcggcacgcagcggttgccgcgcctcgttggc
gttagcaccgcgcttgagatgatccttgcgggcaaacagctgaggccgcgtcaggcgctg
aaagccgggctggtggatgatgtggtgccgcaatctattttgctggaagccgctgccgaa
ctggcgaaaaagcgccgtcccgcgccgcgccgtctgccggttcgcgagcgtttgctcgca
ggcccgattggccgcgcgctgctgtttcgcatggtgacgcagaaaacgcaccagaaaacc
cacggtaactatccggcggcgcagcgcattattgacgtggtgcgcaccggccttgagcag
ggcagtgccagcggttaccaggctgaggcccgcgcctttggcgagctggcgatgacgccg
gaatctgccgcgctgcgagggctgttcttcgccaccaccgagcttaaaaaagagaccggc
agcgaggccgccccgcgcgcgctgcactcggtcggtgtactgggcggcgggctgatgggc
ggcgggattgcgtatgtcaccgccaccaaagcccggttgccggtacgtatcaaagacatc
agcgaaaaaggcattaaccatgccctgaaatacagctgggatctgcttgagaaaaaagtg
cgtcgtcgtcatctgcgcgccagcgagcgcgacgctcaaatggcgctcatctccgccagc
accgattaccgtggatttcaccagcgcgatatcgtcgtggaagcggttttcgaagattta
acgcttaagcaaaacatggtggcagagatcgaggcgcataccgcgccgcatacgattttc
gcgtctaatacctcgtcgctgcctatcggcgatatcgccgcaggcgctacgcgcccggag
caggtgattggcctacactacttcagcccggtggataaaatgccgctggtggaagttatc
ccgcacgcgggcaccagcgcggaaaccattgccaccaccgttcagcttgccaaaaaacag
ggcaaaacgccgatcgtggtggccgactgcgccgggttttatgttaaccgcattctcgct
ccctacatcaatgaggcgatgcgctgcctgatggaaggggagagcattgagaaaatcgac
gaggcgctggtcaaaagaggctttccggtggggccgattcagttgcttgatgaagtgggc
attgatgtcggcaccaaaattatgccggtgctggagcgcgcttacgggccgcgattcagc
gcgccgggagacgccgttgcagcaattttgaatgacgatcgcaaaggcagaaaaaatggc
cgcggtttctatctttatccggcgaaagggcgtaaaagcaaaaaacaggttgaccctgcg
gtttacgggcttattggcgttaaacccggcgggaaactgagcggcgaggagattgccgag
cgctgcgtcatgatgatgcttaacgaggcggcgcggtgtctggatgaaggcgtggtgcgt
tccgcgcgagacggcgatatcggcgcggtgtttggcatcggttttccgccgtttcttggc
ggcccgttccgctatatggacacgctcggcgcggcggccatggcgacgacgctcacgcgt
cttgccacccgttatggagaccgttttaccccgtgcgacaggctgttgcgcatggcgcag
accggacaaacattttggctcgcggggaacctgcaagctgaaatgacggtctga

DBGET integrated database retrieval system