KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01085Help
Entry
ESA_01085         CDS       T00586                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ESA_01085 (folE)
Enzymes [BR:esa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     ESA_01085 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1045986..1046717
Genome map
AA seq 243 aa AA seqDB search
MSHAPPRPGRVWLHLQEKITMPSLSKEAALVHEALVARGLETPLRPPVNELDNETRKRLI
AGHMTEIMQLLNLDLSDDSLMETPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMV
TVRDITLTSTCEHHFVTIDGKATVAYIPKDAVIGLSKINRIVQFFAQRPQVQERLTQQVL
VALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRH
HNG
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagccacgctccgccccggccgggcagagtctggttacacctgcaggagaaaataacg
atgccatcactcagtaaagaagcggccctggttcatgaagcgctggtcgcgcgcggtctg
gagacgccactgcgtccgccggtcaacgagctggataacgaaacccgcaagcgccttatc
gccggtcatatgaccgaaatcatgcagctgcttaatctggatctgagcgatgacagcctg
atggaaacgccgcatcgcatcgccaagatgtatgtggatgagattttctccggcctcgat
tacgccaatttcccgaagattaccgttattgagaacaaaatgaaggtggatgaaatggtc
acggtgcgcgacatcaccctgaccagcacctgcgaacatcactttgtgaccatcgacggt
aaagcgaccgtcgcgtatatcccgaaagacgcggtgatcggcctttcaaaaatcaaccgc
atcgtgcagtttttcgcccagcgtccgcaggtgcaggagcgactgacgcagcaggtactg
gtggcactgcaaacgctgcttggcacgaacaacgtggcggtctccatcgacgcggtgcat
tactgcgtgaaagcgcgcggcatccgcgacgccaccagcgcgaccaccacgacctcgctc
ggcgggctgtttaaatccagccagaacacgcgccaggaatttctgcgcgccgtgcgtcac
cacaacggctaa

DBGET integrated database retrieval system