KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01177Help
Entry
ESA_01177         CDS       T00586                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ESA_01177
   00052 Galactose metabolism
    ESA_01177
   00500 Starch and sucrose metabolism
    ESA_01177
   00520 Amino sugar and nucleotide sugar metabolism
    ESA_01177
Enzymes [BR:esa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ESA_01177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148639..1149529
Genome map
AA seq 296 aa AA seqDB search
MVNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHSSK
NAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPI
IGDNPFVVVLPDVIIDAASADPLRYNLAAMIARFQENGRSQVLAKRMAGDLSEYSVITTQ
DPLDTEGKISRIVDFIEKPDQPQTLNSDLMAVGRYVLSADVWEELAKTEPGAWGRIQLTD
AIARLKENQPVEAMLMTGESYDCGKKMGYMKAFVNYGLRNLKEGQKFRESIKKLLA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggttaatttgaaagcagttattcccgtcgcagggctcggcatgcatatgctgcctgcc
accaaggcgattccaaaggagatgctgccgattgtcgacaaaccgatgattcaatacatt
gtcgacgaaatcgtagcggcagggatcaaggaaattgtgctggttacccactcctccaag
aacgcggttgagaaccacttcgacacctcttacgaactcgaagcgctgcttgaacagcgt
gtgaagcgccaacttcttgcggaagtgcagtctatctgcccgccgggcgtgaccatcatg
aacgtgcgtcaggcgcagccgctgggccttggccactctattctgtgcgcgcgtccgatt
atcggcgataacccgtttgttgtcgtgctgccggatgttattattgatgccgcttctgct
gacccactgcgttataacctggccgctatgattgcgcgcttccaggaaaatggccgcagc
caggtgctggcgaagcgtatggcaggcgatctctctgaatattcagtgataactactcag
gatccgctggatactgaaggcaaaatcagccgtatcgttgatttcatcgagaaaccggac
cagccgcagacgctgaattctgatctgatggcggtcgggcgctatgtgctctctgccgat
gtctgggaagagcttgccaaaaccgaaccgggcgcctggggacgtatccagctgaccgat
gctatcgctcgtctgaaggagaatcagcctgttgaagcgatgctgatgaccggcgaaagc
tacgattgcggtaagaaaatgggttacatgaaagcgttcgtcaattacggcctgcgtaac
ctgaaagaagggcagaagttccgcgagagcattaagaaactgctggcataa

DBGET integrated database retrieval system