KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01220Help
Entry
ESA_01220         CDS       T00586                                 

Definition
AMP nucleosidase
Orthology
K01241  
AMP nucleosidase [EC:3.2.2.4]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Purine metabolism
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:esa00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1190332..1191786)
Genome map
AA seq 484 aa AA seqDB search
MNTTATPLTPDEALDKLEALYDDAVNALREAIAAYINEGRLPDETARAQGLFVYPQLRVC
WDGDGSKAQKTRAYGRFTHPGCYTTTVTRPGLFRSYLREQLILLYEDYGATIEVGPSQHE
IPYPYVIDGSALTLDRSMSAGLTRHFPTTELAQIGDETADGIFHPTEFYPLSHFDARRVD
FSLARLRHYTGTPVEHFQPFVLFTNYTRYVDEFVRWGCSQILDPDSPYVALSCAGGTWIT
ADTEAPEAAISDLAWKKHQMPAWHLITADGQGITLVNIGVGPSNAKTICDHLAVLRPDVW
LMIGHCGGLRESQSIGDYVLAHAYLRDDHVLDAVLPPDIPVPSIAEVQRALYDATKLVSN
MPGEEVKQRLRTGTVVTTDDRNWELRYSASALRFNLSRAVAIDMESATIAAQGYRFRVPY
GTLLCVSDKPLHGEIKLPGQANRFYEGAISEHLQIGIRAIDLLRAEGERLHSRKLRTFNE
PPFR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaataccactgcaacaccactgacgcccgacgaggcgctcgacaaactggaagcgtta
tatgatgacgcggttaacgcgctgcgcgaggcaatcgccgcctatattaacgaaggccgc
ctcccggacgagacagcgcgcgcgcagggtttatttgtctatccgcagttgcgggtatgc
tgggatggtgacggcagcaaagcgcagaagacgcgcgcctacgggcgtttcacccatccg
gggtgttacaccaccaccgttacgcgtcctgggttatttcgcagttatctgcgcgaacag
ctgattctgttgtatgaagactacggcgcgacgattgaagtcggcccttcacagcatgag
atcccctacccgtatgtgattgacggctcggcgctgaccctggatcgttcgatgagcgcc
ggtctgacccgccacttcccgaccaccgagctggcgcagattggcgatgagaccgccgac
gggattttccacccgactgaattctacccgctgtcgcacttcgacgcccgccgcgtcgat
ttctcgctggcgcgtctgcgccactacaccggtacgccggtcgagcatttccagcccttc
gtgctctttaccaactacacgcgctatgtcgatgagtttgtgcgctggggatgcagccag
atcctcgatccggacagcccatacgtggcgctctcgtgcgcgggtggcacctggatcacc
gcggataccgaagcgccggaagcggcgatttccgatctcgcgtggaaaaaacaccagatg
cccgcctggcatttaattaccgccgatggccaaggcattacgctggtgaatatcggcgtc
gggccgtcgaatgccaaaacgatttgcgatcatctcgcggtgctgcgcccggatgtctgg
ctgatgattggccactgcggtggcctgcgtgaaagccagtcgattggcgactacgtgctg
gcgcacgcgtatttgcgcgacgatcacgtgctggacgcggtgctgccgccggatattccg
gtgccgagcatcgccgaagtgcagcgcgcgctctatgacgccacgaagcttgtgagcaat
atgccgggtgaggaagtgaaacagcgtctgcgtaccggcacggtggtgacaaccgacgac
cgcaactgggaactgcgctattcggcctcggcgctgcgctttaacctgagccgcgcggtg
gctatcgatatggaaagcgcgactatcgccgcccagggttatcgcttccgcgtgccttac
ggtacgctgctgtgcgtttccgataaaccgctgcacggtgaaatcaagctgccgggccag
gcgaatcgcttttacgagggcgcgatttccgaacacctgcagattggcattcgcgccatc
gatttactgcgcgcggagggcgaacgcctgcactcgcgcaaactgcgcacctttaacgag
ccgcccttccgctga

DBGET integrated database retrieval system