KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01304Help
Entry
ESA_01304         CDS       T00586                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:esa00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1265080..1266072
Genome map
AA seq 330 aa AA seqDB search
MRFTMQNLTRYARLELIGAPTPLEFLPRLSDYLGREIFIKRDDAMPVAMGGNKLRKLEFL
AAQALREGADTLVTAGAIQSNHVRQTAAVAARLGLHCVALLENPIATREENYLTNGNRLL
LDLFNVQVEMCDALDAPDQQLDELAVRLEAQGFRPYVIPVGGSNVLGALGYVESTLEIVQ
QCEGVVRPSSVVVASGSAGTHAGLAVGLEQGMPEAELIGVTVSRSVAAQKPKVVALQQGV
AKALELEARADILLWDDYFAPGYGVPNDEGMEAVKLLARLEGILLDPVYTGKAMAGLIDG
IAQNRFKDNGPILFIHTGGAPALFAYHPHV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttaccatgcaaaatcttacccgctatgcgcgccttgagcttatcggcgcgccc
acgccgctggagtttctgccgcgcctgtctgactacctgggccgcgaaattttcatcaag
cgcgatgacgcgatgccggtggcgatgggcggcaataagctgcgcaagctggagtttctc
gcagcccaggcgctgcgcgaaggggccgacacgctggtgacggcgggcgcgatacagtct
aaccatgtgcgccagacggcggcagtggccgcgcgcctcggcctgcactgcgtggcgctg
ctggaaaacccgatcgccacgcgcgaagagaattacctcactaacggcaaccggctgctg
ctggatctctttaatgtgcaggtcgagatgtgcgatgcgctggacgcaccagaccagcag
cttgacgagctggcggttcgccttgaagcgcagggcttccggccttatgtcattccggtt
ggcggctcgaacgtgctgggcgcgctcggctatgtcgaaagcacgctcgagatcgtacag
cagtgcgaaggcgtggtgcgcccgtcatccgtagtggtcgcctccggcagcgccggaacg
cacgcggggctcgccgtcgggctggagcaggggatgccggaggctgaacttatcggcgtg
acggtctcgcgaagcgtcgccgcgcagaagccgaaagtcgtcgcgctgcagcagggcgtt
gcaaaagcgctggagctggaagcgcgcgccgatattttactgtgggatgactatttcgcg
ccgggttacggcgtgccgaacgacgagggcatggaagcggtgaagctgctggcgcgtctc
gaaggcattttgcttgacccggtttataccggcaaagcgatggcggggctcattgacggc
atcgcgcagaaccgttttaaagataacggcccgattctctttattcacaccggcggcgct
ccggcgctgttcgcgtaccatccgcatgtctga

DBGET integrated database retrieval system