KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01351Help
Entry
ESA_01351         CDS       T00586                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:esa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ESA_01351
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    ESA_01351
Enzymes [BR:esa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     ESA_01351
Two-component system [BR:esa02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   ESA_01351
Bacterial motility proteins [BR:esa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    ESA_01351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1306780..1307829
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKQFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAVDFVTKPQLGIREGMLAYS
ELIADKVRTASRARISARLPDAVPKTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVLITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPAVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMHQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtgttgtcagtagatgattcggcgctgatgcgtcaaatcatgacc
gaaattatcaacagccacagcgatatggagatggtggcgacggcgccggacccgctggtg
gcgcgcgatctgattaagcagttcaacccggatgtcttaacgctggatgttgaaatgccg
cgcatggatggcctcgatttcctggaaaaactgatgcgtctgcgtccgatgccggtggtc
atggtctcttcgctgacgggaaaaggctctgaagtgacgctgcgcgcgctggagctgggc
gcggtggatttcgtgaccaagccgcagcttggcattcgtgaagggatgctggcgtacagc
gaactgattgccgataaagtgcgtaccgcctcgcgtgcgcggatttccgcccgcctgccg
gacgcggtgccgaaaacgctgaaagcaggcccgctgttgagttcggaaaaactgattgcc
attggtgcctccacgggcggcaccgaagcgattcgccatgtgctccagccgctgccgctc
tcaagcccggcggtactgattacccagcacatgccgcctggatttacccgttctttcgcc
gagcgactgaacaagctgtgccagattagcgtgaaagaagccgaagacggcgagcgcgtg
ctgccgggccatgcctatatcgcgccaggcgataagcatatggagctcgcgcgcagcggc
gctaactaccagataaaaatccacgacgggccgccggttaaccggcaccgtccggccgtg
gatgtgttgtttcactccgtagccaaacatgcggggcgcaacgcggtgggcgtgatcctc
accgggatgggcaacgatggcgcggcgggaatgctggcgatgcaccaggcgggcgcctgg
accatcgcccaaaacgaagcgagttgtgtggtgttcggcatgccgcgtgaggccatcaat
atgggtggcgtcagcgaagtcgtcgatctaagccaggtcagccagcagatgctggcgaaa
atcagtgccggacaggcaatacgtatttaa

DBGET integrated database retrieval system