KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01380Help
Entry
ESA_01380         CDS       T00586                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:esa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ESA_01380 (ruvA)
Enzymes [BR:esa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ESA_01380 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1334709..1335320
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIVLEKQPPLVLLEAGGVGYEVHMPMTCFYELPETGKEAVVFTHFVVREDAQLL
FGFNNKQERTLFRELIKVNGVGPKLALAILSGMSAQQFVNAVEREEPAALVKLPGIGKKT
AERLVVEMKDRFKGLHGDLFTPAADLVLTSPASPAVDDAEAEAVAALVSLGYKPQEASRM
VSKVAQADASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcgtactggaaaaacagcccccgctggtgttactggag
gcgggcggcgtcggttatgaagtccatatgccgatgacctgcttttatgaattgccggaa
accggtaaagaggcggtggtcttcacccattttgtcgtgcgtgaagacgcgcagttactg
ttcggctttaataacaaacaagagcgcacgctttttcgcgagctgatcaaggtcaacggc
gtcggcccgaaactggcgctggcgatcctctccggtatgtcggcccagcagttcgtgaac
gcggttgagcgcgaagagcctgccgcgctggtcaaactgccgggcatcggcaagaaaacc
gccgaacgtctagtggtggagatgaaagaccgcttcaaaggcctgcatggcgatctcttc
acgccagcggcggatctggtgctgacgtcgcctgcaagcccagcggtggatgacgctgag
gcggaagccgttgccgcgctggtgtcgctgggttataaacctcaggaagccagccgtatg
gtcagtaaagtcgcacaggcggatgcgagcagcgaaacgctgattcgcgaagcgctgcgc
gcggcattgtga

DBGET integrated database retrieval system