KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01539Help
Entry
ESA_01539         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00010  Glycolysis / Gluconeogenesis
esa00071  Fatty acid degradation
esa00350  Tyrosine metabolism
esa00620  Pyruvate metabolism
esa00625  Chloroalkane and chloroalkene degradation
esa00626  Naphthalene degradation
esa00650  Butanoate metabolism
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01120  Microbial metabolism in diverse environments
esa01130  Biosynthesis of antibiotics
esa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_01539
   00620 Pyruvate metabolism
    ESA_01539
   00650 Butanoate metabolism
    ESA_01539
  Lipid metabolism
   00071 Fatty acid degradation
    ESA_01539
  Amino acid metabolism
   00350 Tyrosine metabolism
    ESA_01539
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ESA_01539
   00626 Naphthalene degradation
    ESA_01539
Enzymes [BR:esa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ESA_01539
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ESA_01539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABU76793
UniProt: A7MMH9
Position
complement(1486093..1488771)
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILDEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSVYDAVRERFASHGGYLLQGAELKAVQNIILKNGALNAAIVGQP
AVKIAEMAGITVPSSTKILIGEVSLVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPARVTFFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RAMIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDETGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEVAD
HLGLTAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDSFYGREYKEGAEAVKAEAAPVAKADKKAKKTV
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaactaaacgccctcgtcgagcgcgtcaaaaaagcccag
cgtgaatatgccaacttcacccaagaacaggttgacaaaatcttccgcgccgccgctctg
gccgctgcagatgctcgaatccccctcgctaaaatggccgttgccgaatccggaatgggt
atcgtcgaagataaagtgatcaaaaaccactttgcttctgaatatatctacaacgcctat
aaagacgagaaaacctgcggcattctcgacgaagatgacacctttggtacgattaccatc
gctgaacctatcggcatcatctgcggtatcgttccgaccactaacccaacgtctaccgcc
attttcaaatcgcttatcagcctgaaaacccgtaacgcgatcattttctctccgcatccg
cgtgcgaaagatgcaactaataaggcagcggatatcgtgctgcaagccgctatcgctgca
ggcgcgccgaaagatctgatcggctggattgatcagccttccgttgagctgtctaacgcg
ctgatgcatcacccggatatcaacctgattctggccacgggtggcccgggcatggtgaaa
gcagcgtacagctccggtaagcctgcgatcggcgtaggtgctggtaacacgccggttgtt
atcgacgaaacagccgatatcaaacgcgctgtcgcttctatcctgatgtctaagacgttt
gataacggcgttatctgtgcctctgaacagtctgtcatcgtggttgattctgtttatgat
gcggtgcgcgaacgtttcgcgagccacggcggctacctgctgcagggcgcggaactgaaa
gccgtgcagaatatcattctgaagaatggcgcgctgaacgcagctatcgtaggtcagccg
gcggtaaaaatcgccgagatggcaggcatcactgtgccgtccagcactaagatcctgatt
ggcgaagtctctctggtggatgaaagcgaaccgttcgctcatgagaaactctctccgacc
ctcgccatgtatcgcgcgaaagatttcgaagatgccgttgaaaaagcggaaaaactggtt
gcgatgggcggtatcggtcatacctcttgcctgtacactgaccaggataaccaaccggct
cgcgtcactttcttcggcgataaaatgaaaaccgcgcgtatccttatcaacacgccggct
tctcagggtggtatcggggatctctacaacttcaagctggcgccgtctctaacgctgggt
tgcggctcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcataaacttccgaaatctatc
tacttccgtcgcggctcactgccgattgcgctggatgaagtgattactgatggtcacaaa
cgcgccatgatcgtgactgaccgcttcctgttcaacaacggttatgccgaccagatcact
tccgtactgaaagcggctggtgttgaaactgaagtgttctttgaagtagaagctgaccca
accctgagcgtggttcgcaaaggcgctgagctgatgaactcctttaaaccggacgttatc
atcgcgctcggtggtggctccccgatggatgccgcgaaaatcatgtgggtcatgtacgaa
cacccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggt
accggttctgaagttacgccgtttgcggtggttaccgacgacgaaaccggtcagaaatat
ccgctggcggactacgccctgactccggatatggcgattgtcgatgccaacctggtgatg
gatatgccgaagtcactctgcgccttcggtggtctggatgcggtcactcacgcgctggaa
gcttacgtttctgtactggcctctgaattctccgatggtcaggcgctgcaggcactgaaa
ctgctgaaagaaaacctgccggcgtcttaccatgaaggttcgaaaaacccggttgcgcgt
gaacgtgttcacagtgctgcgactatcgccggtatcgcgtttgcgaacgccttcctcggc
gtgtgtcactccatggctcacaaactgggttcacagttccacattccgcatggtctggcg
aacgccctgctgatttctaacgttatccgctataacgcgaacgataacccgaccaagcag
accgctttcagccagtatgaccgtccgcaggcgcgtcgccgttatgctgaagtggccgac
catctgggtctcactgcaccgggcgaccgtaccgcagcgaaaattgagaaactgctggca
tggctggaaagcatcaaagctgagctgggtattccgaaatctatccgtgaagcgggcgtt
caggaagccgacttcctggcccatgttgataaactgtctgaagatgccttcgatgaccag
tgtactggcgctaacccgcgctacccgctgattgccgagctgaaacagatcctgctggat
agcttctacggtcgtgaatacaaagaaggtgctgaagctgtaaaagctgaagccgctcct
gtcgcgaaagctgacaaaaaagccaagaaaacggtttaa

DBGET integrated database retrieval system