KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01558Help
Entry
ESA_01558         CDS       T00586                                 

Definition
(GenBank) hypothetical protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
esa00260  Glycine, serine and threonine metabolism
esa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
esa01100  Metabolic pathways
esa01110  Biosynthesis of secondary metabolites
esa01130  Biosynthesis of antibiotics
esa01230  Biosynthesis of amino acids
Module
esa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ESA_01558
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ESA_01558
Enzymes [BR:esa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ESA_01558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Amidohydro_2 NMO His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABU76812
UniProt: A7MMG7
Position
complement(1507776..1508585)
Genome map
AA seq 269 aa AA seqDB search
MERYQQLFDRLAARKEGAFVPFVTLGDPSPEQSLQIIDALVEGGADALELGIPFSDPLAD
GPTIQSATLRAFASGTTPDQCFEMLAAVRQKYPDLPIGLLMYANLVFSRGVDEFYARCAA
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLINKLTEYHAAPPLQGFGISEPAQVKAAIEAGAAGAISGSAIVKI
IENNLNDRAAMLESLKTFVRQLKAASLPA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttatcagcagctgtttgaccgcctggcagcccgtaaggaaggcgcgtttgtt
ccctttgtgacgctcggcgacccgtcgcccgagcagtcgttacagattatcgacgcgctg
gtggaaggcggcgctgacgcgctggagctcggcattccgttctccgatccgctggcggat
ggcccgacgatccagagtgcgacgctgcgcgcgttcgcttcgggcaccacgccggatcag
tgctttgaaatgctggccgcggtgcgtcagaaatacccggacttacccatcgggctatta
atgtatgccaacctggtgttcagccgcggcgtggacgaattctacgcccgctgcgccgcc
gtcggcgtcgattcggtcctggtggccgatgtgccggtggaagaatccgcgcctttccgc
caggcggcgatgcgccacaatgttgcgccaattttcatctgcccgccaaatgccgatgac
gatctgctgcgccagattgcgtcttatggccgcggttatacttatttactgtcgcgtgcc
ggggtgacaggcgcggaaaaccgcgccgcgctgccgctgaatcacctgattaataaactc
accgaataccacgccgcgccgccgttgcaagggttcgggatctcagagcctgcgcaggtg
aaagccgctattgaggccggtgccgcaggcgcgatttctggctcggcgatcgtcaagatc
atcgagaacaacctgaacgatcgcgcagcgatgctggagtcgctgaaaacgtttgtgcgc
cagttaaaagcggccagtttacctgcctga

DBGET integrated database retrieval system