KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01602Help
Entry
ESA_01602         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:esa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1554480..1556210
Genome map
AA seq 576 aa AA seqDB search
MEISIMENITPFTINLDAIKNLIARIYGDGFTTSHYETLEKHISETRKAITVPRKKGWDE
TDVVLITYADQFSAPGEKRLATFQRFFEKWLKPYFSHIHLLPFYPWSSDDGFSVVDYHRV
DPQCGDWGDIARLNTQARLMFDFVCNHISAQSEWFADYLAQKPGYEDFFIAVDPATDLSA
VTRPRALPLLTPFTMQNGRVRHLWTTFSEDQIDLNFASPVVLLAMVDVLLHYLREGAQYV
RLDAVGFMWKTPGTSCIHLEKTHLLVKLFRAIADVVAPGTVIITETNVPHKDNIAYLGNG
FDEAQMVYQFPLPPLLLHAIHTQNARTLCEWAQGLSDARIGETTWFNFLASHDGIGLNPL
RGILPEDAILRLVEDLQAQGARVNWKNNPDGTRSPYEINVTYMDALSLQNDSDATRLARF
LLAHALLLTFPGVPAIYIQSILGSRNDEEGVELLGYNRAINRQKYTEAEMNVALQAEGNL
RHETWKQLGELISLRRQHAAFHPDSAFAARCINDAVLEIMRVADNGATVIALFNLSDTAQ
VIDYDARGCRELITGATINSDSLILAPWKAMWLSKA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatcaataatggaaaatataacccctttcacgataaatctcgacgcgattaaa
aatctgatcgcgcgaatttatggcgatggatttactacttcgcattacgaaacactcgaa
aaacatatttcagaaacgcgtaaagccattacagtgccacgtaaaaaaggctgggatgaa
accgatgtggtattaattacctatgccgatcagttcagcgcgcccggtgaaaaacgcctc
gcgacttttcagcgcttttttgaaaagtggttaaaaccgtatttttctcatattcatctt
ttgccgttttatccctggtcgtctgacgacggattttcggtggtggattaccaccgcgtc
gacccacagtgcggcgactggggcgatatcgcgaggcttaatacccaggcgcggctgatg
tttgacttcgtctgcaaccatatttccgcccagagtgaatggtttgcagattatctcgcg
caaaaaccgggctatgaagatttctttattgccgttgacccggcgacggatttatccgcc
gtcacccgaccgcgcgcgttgccgttattaacaccgtttacgatgcaaaacggccgggta
cgtcacctgtggaccaccttcagcgaagatcagattgacctcaatttcgccagcccggtt
gttctgctggcgatggtggatgtccttttgcattatctgcgcgaaggggcgcaatatgtc
cgcctcgacgccgtcggctttatgtggaaaacacctggaacgagctgtatccatctggaa
aaaacacatctgttagtgaagctgttccgcgcgatcgccgatgtggtggctccgggcact
gtgatcatcaccgaaactaacgtaccgcataaagacaatatcgcgtatctgggtaatggg
tttgatgaggcgcagatggtgtaccagttcccgctgccgccgctgctgctgcatgctatt
catacccaaaatgcccgcacgctctgcgagtgggcgcaggggttaagtgacgcgcgtatc
ggtgaaaccacctggtttaatttcctggcgtcgcatgacggcatcgggcttaatccgctg
cgcggcattcttcccgaagacgcgattttacgcctggtggaagaccttcaggcgcaaggc
gcgcgggtcaactggaaaaataacccggatggcacgcgcagcccgtatgaaattaacgtc
acgtatatggatgcccttagtttacagaatgacagcgacgcgacgcgccttgcgcgtttt
ttgctggcgcacgcgctgttattaaccttccccggcgttccggcgatttatattcaaagt
attctcggctcgcgcaatgatgaagagggcgttgaactgcttggctataaccgcgctatt
aatcgtcaaaaatataccgaggcggaaatgaacgtggcgctacaggccgaagggaattta
cgccacgaaacgtggaagcaactcggcgagcttatttcgcttcgccgccagcacgcggcg
tttcatcccgacagcgcctttgccgctcgctgtattaatgatgcagtgctggaaattatg
cgcgttgcagataatggcgcgacggtcattgccctctttaatcttagcgataccgcgcag
gttattgattatgacgcccgcggctgtcgtgaattaattaccggcgcgacgataaatagt
gactcgctgattcttgccccatggaaagcaatgtggcttagcaaagcctga

DBGET integrated database retrieval system