KEGG   Cronobacter sakazakii ATCC BAA-894: ESA_01682Help
Entry
ESA_01682         CDS       T00586                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
esa  Cronobacter sakazakii ATCC BAA-894
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:esa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ESA_01682
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESA_01682
  Lipid metabolism
   00071 Fatty acid degradation
    ESA_01682
  Amino acid metabolism
   00350 Tyrosine metabolism
    ESA_01682
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ESA_01682
   00626 Naphthalene degradation
    ESA_01682
Enzymes [BR:esa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ESA_01682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1620976..1622007
Genome map
AA seq 343 aa AA seqDB search
MKVMKMKAAVVKAFGQPLEIQEVLVPEVTPGKVLVKIAATGVCHTDLHAAEGDWPVKPNP
SFIPGHEGVGHVVAVGQGVTHIKEGDRVGVPWLYSACGHCEHCLGGWETLCHSQQNSGYS
VNGSFAEYCLADANYVGILPDNVEFTHIAPILCAGVTVYKGLKMTDTKPGDWVVISGIGG
LGHLAIQYANAMGLNVAAVDIDNDKLEFAKRLGAQVTANALDVDPGSYFHDTFGGAHGVL
VTAVSPKAFAQATTMMRRGGTMVLNGLPPGKFDLSIFDMVLDGTTVRGSIVGTRKDLQEA
LDFAGHNKVAAEIAVEPLENINDIFDRMRNGKITGRIVVDMSL
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgatgaaaatgaaagcggccgtggtcaaggccttcgggcagccgctggagatc
caggaagtgctggtgccggaagtcacaccaggtaaagtgctggtaaaaatcgcggcgacc
ggcgtgtgtcataccgatctccacgcggcggaaggtgactggccggtgaagccgaacccg
tcatttattccgggccatgaaggcgtggggcatgtcgtggcggtcggccagggcgtgacg
cacattaaagagggggatcgcgtgggcgtgccgtggctctattccgcctgcgggcactgc
gaacactgtctcgggggctgggaaacgctttgtcacagccagcaaaactcaggctattcg
gttaatgggagctttgccgagtattgtctggcagacgccaattatgtgggcatcctgccg
gataacgtcgagtttacccatatcgcgccgatcctctgtgcgggggtgacggtttataaa
gggctgaaaatgaccgacaccaaaccgggcgactgggtggtgatttccggcatcggcggg
ttagggcatctggcgattcagtacgccaacgcgatggggctgaacgtggcggcggtggat
attgataacgataagctggagtttgcgaaacgcctcggcgcgcaggtgacggccaacgcg
ctggacgtcgatccgggcagctatttccatgacactttcggcggcgcgcacggcgtactg
gtgacggcggtgtcgccaaaagcgttcgcccaagcgaccaccatgatgcgccgcggcggt
acaatggtgctgaacggcctgccgccgggtaaattcgatctctctatctttgatatggtg
ctggacggcaccacggtgcgcggctcgattgtcggtacgcgtaaagatctccaggaggcg
cttgatttcgcgggtcataataaagtagcggcggaaattgcggtcgagccgctggagaat
atcaacgatattttcgaccgtatgcgtaacgggaaaattaccggtcgcatcgtggtggat
atgtcgctgtaa

DBGET integrated database retrieval system